BLASTX nr result
ID: Ophiopogon22_contig00004536
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00004536 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59809.1| uncharacterized protein A4U43_C08F10930 [Asparagu... 89 8e-21 ref|XP_020240797.1| elongation factor 1-delta-like [Asparagus of... 89 2e-19 ref|XP_020240796.1| elongation factor 1-delta 1-like [Asparagus ... 89 2e-19 gb|PNX86230.1| elongation factor 1-delta-like protein [Trifolium... 82 4e-18 gb|AIZ68132.1| translation elongation factor 1-delta 1 [Ornithog... 85 8e-18 dbj|GAU29695.1| hypothetical protein TSUD_264310, partial [Trifo... 85 9e-18 gb|PNX69064.1| elongation factor 1-delta-like protein [Trifolium... 80 1e-17 ref|XP_004507191.1| PREDICTED: elongation factor 1-delta 2-like ... 82 9e-17 ref|XP_019167086.1| PREDICTED: elongation factor 1-delta-like [I... 80 4e-16 ref|XP_013464060.1| elongation factor 1-beta [Medicago truncatul... 79 7e-16 ref|XP_012079853.1| elongation factor 1-delta 1 [Jatropha curcas... 80 9e-16 dbj|BAT82838.1| hypothetical protein VIGAN_03290700 [Vigna angul... 80 9e-16 ref|XP_007160678.1| hypothetical protein PHAVU_001G007700g [Phas... 80 9e-16 gb|AGV54252.1| elongation factor 1 beta [Phaseolus vulgaris] 80 9e-16 gb|KDO52641.1| hypothetical protein CISIN_1g027254mg [Citrus sin... 79 1e-15 ref|XP_006477015.1| PREDICTED: elongation factor 1-delta 1 [Citr... 79 1e-15 ref|XP_020212429.1| elongation factor 1-delta-like [Cajanus cajan] 79 1e-15 gb|KYP69569.1| Elongation factor 1-delta [Cajanus cajan] 79 1e-15 ref|XP_004493894.1| PREDICTED: elongation factor 1-delta 2-like ... 79 1e-15 dbj|GAU17158.1| hypothetical protein TSUD_177880 [Trifolium subt... 79 2e-15 >gb|ONK59809.1| uncharacterized protein A4U43_C08F10930 [Asparagus officinalis] Length = 100 Score = 89.4 bits (220), Expect = 8e-21 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYISGYQASKDDITVYSAIPS+PS E+VNV RWYKHIDAL+RMCG Sbjct: 25 SYISGYQASKDDITVYSAIPSVPSDEYVNVCRWYKHIDALIRMCG 69 >ref|XP_020240797.1| elongation factor 1-delta-like [Asparagus officinalis] Length = 230 Score = 89.4 bits (220), Expect = 2e-19 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYISGYQASKDDITVYSAIPS+PS E+VNV RWYKHIDAL+RMCG Sbjct: 25 SYISGYQASKDDITVYSAIPSVPSDEYVNVCRWYKHIDALIRMCG 69 >ref|XP_020240796.1| elongation factor 1-delta 1-like [Asparagus officinalis] Length = 231 Score = 89.4 bits (220), Expect = 2e-19 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYISGYQASKDDITVYSAIPS+PS E+VNV RWYKHIDAL+RMCG Sbjct: 25 SYISGYQASKDDITVYSAIPSVPSDEYVNVCRWYKHIDALIRMCG 69 >gb|PNX86230.1| elongation factor 1-delta-like protein [Trifolium pratense] Length = 68 Score = 81.6 bits (200), Expect = 4e-18 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRM 129 SYISGYQASKDDITVY+A+PS+PSSE+VNV+RWYKHIDAL+R+ Sbjct: 25 SYISGYQASKDDITVYAALPSVPSSEYVNVARWYKHIDALLRI 67 >gb|AIZ68132.1| translation elongation factor 1-delta 1 [Ornithogalum longebracteatum] Length = 229 Score = 85.1 bits (209), Expect = 8e-18 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYISGYQASKDD+ V+S+IPSLPS E+VNV RWYKHIDAL+RMCG Sbjct: 25 SYISGYQASKDDLAVFSSIPSLPSEEYVNVCRWYKHIDALIRMCG 69 >dbj|GAU29695.1| hypothetical protein TSUD_264310, partial [Trifolium subterraneum] Length = 219 Score = 84.7 bits (208), Expect = 9e-18 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYISGYQASKDDITVY+A+PS+PSSEFVNV+RWYKHIDAL+R+ G Sbjct: 31 SYISGYQASKDDITVYAALPSVPSSEFVNVARWYKHIDALLRISG 75 >gb|PNX69064.1| elongation factor 1-delta-like protein [Trifolium pratense] Length = 68 Score = 80.5 bits (197), Expect = 1e-17 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRM 129 SYI+GYQASKDDITVYSA+PS+PS EFVNV+RWYKHIDAL+R+ Sbjct: 25 SYITGYQASKDDITVYSALPSVPSVEFVNVARWYKHIDALLRI 67 >ref|XP_004507191.1| PREDICTED: elongation factor 1-delta 2-like [Cicer arietinum] Length = 233 Score = 82.4 bits (202), Expect = 9e-17 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYISGYQASKDDITVYSA+ S+PS EFVNVSRWYKHIDAL+R+ G Sbjct: 25 SYISGYQASKDDITVYSALSSVPSDEFVNVSRWYKHIDALLRISG 69 >ref|XP_019167086.1| PREDICTED: elongation factor 1-delta-like [Ipomoea nil] Length = 224 Score = 80.5 bits (197), Expect = 4e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDDITVYS++P PSSE+VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDITVYSSLPKPPSSEYVNVSRWYKHIDALLRISG 69 >ref|XP_013464060.1| elongation factor 1-beta [Medicago truncatula] gb|KEH38095.1| elongation factor 1-beta [Medicago truncatula] Length = 183 Score = 79.0 bits (193), Expect = 7e-16 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDDITVYSA+PS+PS E+ NV+RWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDITVYSALPSVPSYEYGNVARWYKHIDALLRIAG 69 >ref|XP_012079853.1| elongation factor 1-delta 1 [Jatropha curcas] gb|KDP30930.1| hypothetical protein JCGZ_11306 [Jatropha curcas] Length = 230 Score = 79.7 bits (195), Expect = 9e-16 Identities = 34/45 (75%), Positives = 42/45 (93%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDD+TVY+A+P PSS++VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDVTVYAALPKAPSSQYVNVSRWYKHIDALLRISG 69 >dbj|BAT82838.1| hypothetical protein VIGAN_03290700 [Vigna angularis var. angularis] Length = 231 Score = 79.7 bits (195), Expect = 9e-16 Identities = 34/45 (75%), Positives = 43/45 (95%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDD+TVY+A+P+ PS+E+VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDLTVYAALPTAPSAEYVNVSRWYKHIDALLRISG 69 >ref|XP_007160678.1| hypothetical protein PHAVU_001G007700g [Phaseolus vulgaris] gb|ESW32672.1| hypothetical protein PHAVU_001G007700g [Phaseolus vulgaris] Length = 231 Score = 79.7 bits (195), Expect = 9e-16 Identities = 34/45 (75%), Positives = 43/45 (95%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDD+TVY+A+P+ PS+E+VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDLTVYAALPTAPSAEYVNVSRWYKHIDALLRISG 69 >gb|AGV54252.1| elongation factor 1 beta [Phaseolus vulgaris] Length = 231 Score = 79.7 bits (195), Expect = 9e-16 Identities = 34/45 (75%), Positives = 43/45 (95%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDD+TVY+A+P+ PS+E+VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDLTVYAALPTAPSAEYVNVSRWYKHIDALLRISG 69 >gb|KDO52641.1| hypothetical protein CISIN_1g027254mg [Citrus sinensis] gb|KDO52642.1| hypothetical protein CISIN_1g027254mg [Citrus sinensis] gb|KDO52643.1| hypothetical protein CISIN_1g027254mg [Citrus sinensis] Length = 226 Score = 79.3 bits (194), Expect = 1e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDDITVYSA+ PSSE+VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISG 69 >ref|XP_006477015.1| PREDICTED: elongation factor 1-delta 1 [Citrus sinensis] ref|XP_006477016.1| PREDICTED: elongation factor 1-delta 1 [Citrus sinensis] ref|XP_024045487.1| elongation factor 1-delta 1 [Citrus clementina] ref|XP_024045488.1| elongation factor 1-delta 1 [Citrus clementina] gb|KDO52644.1| hypothetical protein CISIN_1g027254mg [Citrus sinensis] gb|KDO52645.1| hypothetical protein CISIN_1g027254mg [Citrus sinensis] Length = 226 Score = 79.3 bits (194), Expect = 1e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDDITVYSA+ PSSE+VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISG 69 >ref|XP_020212429.1| elongation factor 1-delta-like [Cajanus cajan] Length = 230 Score = 79.3 bits (194), Expect = 1e-15 Identities = 34/45 (75%), Positives = 42/45 (93%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDD+TVY+A+P+ PS E+VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDLTVYAALPNAPSDEYVNVSRWYKHIDALLRISG 69 >gb|KYP69569.1| Elongation factor 1-delta [Cajanus cajan] Length = 232 Score = 79.3 bits (194), Expect = 1e-15 Identities = 34/45 (75%), Positives = 42/45 (93%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDD+TVY+A+P+ PS E+VNVSRWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDLTVYAALPNAPSDEYVNVSRWYKHIDALLRISG 69 >ref|XP_004493894.1| PREDICTED: elongation factor 1-delta 2-like [Cicer arietinum] Length = 232 Score = 79.3 bits (194), Expect = 1e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SY+SGY ASKDDITVYSA+ S+PS EFVNVSRWYKHIDAL+R+ G Sbjct: 25 SYVSGYLASKDDITVYSALSSVPSDEFVNVSRWYKHIDALLRISG 69 >dbj|GAU17158.1| hypothetical protein TSUD_177880 [Trifolium subterraneum] Length = 227 Score = 79.0 bits (193), Expect = 2e-15 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = +1 Query: 1 SYISGYQASKDDITVYSAIPSLPSSEFVNVSRWYKHIDALVRMCG 135 SYI+GYQASKDD+TVYSA+ S+PS EFVNV+RWYKHIDAL+R+ G Sbjct: 25 SYITGYQASKDDVTVYSALSSVPSVEFVNVARWYKHIDALLRISG 69