BLASTX nr result
ID: Ophiopogon22_contig00004327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00004327 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261908.1| la-related protein 6B-like [Asparagus offici... 58 2e-07 >ref|XP_020261908.1| la-related protein 6B-like [Asparagus officinalis] Length = 475 Score = 58.2 bits (139), Expect = 2e-07 Identities = 33/57 (57%), Positives = 41/57 (71%) Frame = -2 Query: 350 LEMADDQISDRMRPESPTADPSLSRNVSFSRLNARAPEFVPWAPAPAMNHGGANRGK 180 L++A+D+I+D +R ES T DP LSRNV SRLNA APEFVP AP + + GA R K Sbjct: 11 LDIAEDRITDCLRAESLTDDPLLSRNVYLSRLNACAPEFVP--RAPLLANQGAQRVK 65