BLASTX nr result
ID: Ophiopogon22_contig00003801
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00003801 (695 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242366.1| monothiol glutaredoxin-S15, mitochondrial is... 59 5e-07 ref|XP_020242365.1| monothiol glutaredoxin-S15, mitochondrial is... 59 5e-07 ref|XP_020685906.1| monothiol glutaredoxin-S15, mitochondrial [D... 55 6e-06 ref|XP_020105263.1| monothiol glutaredoxin-S4, mitochondrial-lik... 55 8e-06 gb|OAY76167.1| Monothiol glutaredoxin-S4, mitochondrial [Ananas ... 55 9e-06 gb|OAY82719.1| Monothiol glutaredoxin-S4, mitochondrial [Ananas ... 55 1e-05 >ref|XP_020242366.1| monothiol glutaredoxin-S15, mitochondrial isoform X2 [Asparagus officinalis] gb|ONK59502.1| uncharacterized protein A4U43_C08F7090 [Asparagus officinalis] Length = 169 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 693 GEFIGGSDIVLNMHQQGQLKELVADIGADNGK 598 GEF+GGSDIVLNMHQQGQL+EL+ADI AD+ K Sbjct: 136 GEFVGGSDIVLNMHQQGQLRELLADINADSSK 167 >ref|XP_020242365.1| monothiol glutaredoxin-S15, mitochondrial isoform X1 [Asparagus officinalis] Length = 170 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 693 GEFIGGSDIVLNMHQQGQLKELVADIGADNGK 598 GEF+GGSDIVLNMHQQGQL+EL+ADI AD+ K Sbjct: 137 GEFVGGSDIVLNMHQQGQLRELLADINADSSK 168 >ref|XP_020685906.1| monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] ref|XP_020685907.1| monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] gb|PKU83482.1| Monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] Length = 170 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 693 GEFIGGSDIVLNMHQQGQLKELVADIGADNGK 598 GEFIGGSDIVL+MHQ GQLKEL++DI DN K Sbjct: 135 GEFIGGSDIVLSMHQNGQLKELLSDINGDNSK 166 >ref|XP_020105263.1| monothiol glutaredoxin-S4, mitochondrial-like [Ananas comosus] ref|XP_020105264.1| monothiol glutaredoxin-S4, mitochondrial-like [Ananas comosus] Length = 166 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 693 GEFIGGSDIVLNMHQQGQLKELVADIGADNGKA 595 GEF+GGSDIVLNMHQ G+LKEL+ DIG ++G++ Sbjct: 134 GEFVGGSDIVLNMHQNGELKELLVDIGKESGES 166 >gb|OAY76167.1| Monothiol glutaredoxin-S4, mitochondrial [Ananas comosus] Length = 174 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 693 GEFIGGSDIVLNMHQQGQLKELVADIGADNGKA 595 GEF+GGSDIVLNMHQ G+LKEL+ DIG ++G++ Sbjct: 142 GEFVGGSDIVLNMHQNGELKELLVDIGKESGES 174 >gb|OAY82719.1| Monothiol glutaredoxin-S4, mitochondrial [Ananas comosus] Length = 180 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 693 GEFIGGSDIVLNMHQQGQLKELVADIGADNGKA 595 GEF+GGSDIVLNMHQ G+LKEL+ DIG ++G++ Sbjct: 148 GEFVGGSDIVLNMHQNGELKELLVDIGKESGES 180