BLASTX nr result
ID: Ophiopogon22_contig00003800
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00003800 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242366.1| monothiol glutaredoxin-S15, mitochondrial is... 62 5e-09 ref|XP_020242365.1| monothiol glutaredoxin-S15, mitochondrial is... 62 5e-09 ref|XP_020685906.1| monothiol glutaredoxin-S15, mitochondrial [D... 56 1e-06 >ref|XP_020242366.1| monothiol glutaredoxin-S15, mitochondrial isoform X2 [Asparagus officinalis] gb|ONK59502.1| uncharacterized protein A4U43_C08F7090 [Asparagus officinalis] Length = 169 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 456 GEFIGGSDIVLNMHQQGQLKELVADINADSDK 361 GEF+GGSDIVLNMHQQGQL+EL+ADINADS K Sbjct: 136 GEFVGGSDIVLNMHQQGQLRELLADINADSSK 167 >ref|XP_020242365.1| monothiol glutaredoxin-S15, mitochondrial isoform X1 [Asparagus officinalis] Length = 170 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 456 GEFIGGSDIVLNMHQQGQLKELVADINADSDK 361 GEF+GGSDIVLNMHQQGQL+EL+ADINADS K Sbjct: 137 GEFVGGSDIVLNMHQQGQLRELLADINADSSK 168 >ref|XP_020685906.1| monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] ref|XP_020685907.1| monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] gb|PKU83482.1| Monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] Length = 170 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 456 GEFIGGSDIVLNMHQQGQLKELVADINADSDK 361 GEFIGGSDIVL+MHQ GQLKEL++DIN D+ K Sbjct: 135 GEFIGGSDIVLSMHQNGQLKELLSDINGDNSK 166