BLASTX nr result
ID: Ophiopogon22_contig00003785
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00003785 (2691 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249607.1| cysteine synthase-like [Asparagus officinalis] 84 4e-15 ref|XP_020269729.1| cysteine synthase, chloroplastic/chromoplast... 86 1e-14 ref|XP_020269728.1| cysteine synthase, chloroplastic/chromoplast... 86 1e-14 gb|ONK66579.1| uncharacterized protein A4U43_C06F9820 [Asparagus... 83 2e-14 ref|XP_020269726.1| cysteine synthase-like isoform X1 [Asparagus... 86 3e-14 ref|XP_009388576.1| PREDICTED: cysteine synthase [Musa acuminata... 86 4e-14 gb|ONK55670.1| uncharacterized protein A4U43_UnF330 [Asparagus o... 84 8e-14 gb|ONK66585.1| uncharacterized protein A4U43_C06F9890 [Asparagus... 83 1e-13 ref|XP_020271252.1| bifunctional cystathionine gamma-lyase/cyste... 83 3e-13 ref|XP_020587742.1| cysteine synthase-like [Phalaenopsis equestris] 77 3e-11 ref|XP_010915296.1| PREDICTED: cysteine synthase, chloroplastic/... 75 8e-11 ref|XP_010915295.1| PREDICTED: cysteine synthase isoform X2 [Ela... 75 1e-10 ref|XP_019704868.1| PREDICTED: cysteine synthase isoform X1 [Ela... 75 1e-10 ref|XP_010915297.1| PREDICTED: cysteine synthase-like [Elaeis gu... 75 1e-10 ref|XP_020100781.1| cysteine synthase-like [Ananas comosus] 74 4e-10 ref|XP_020100056.1| cysteine synthase-like [Ananas comosus] >gi|... 73 8e-10 gb|OAY85500.1| Cysteine synthase, chloroplastic/chromoplastic [A... 74 1e-09 ref|XP_020702204.1| cysteine synthase-like [Dendrobium catenatum... 71 3e-09 ref|XP_020087943.1| cysteine synthase-like [Ananas comosus] 70 7e-09 gb|OAY83965.1| Bifunctional L-3-cyanoalanine synthase/cysteine s... 70 8e-09 >ref|XP_020249607.1| cysteine synthase-like [Asparagus officinalis] Length = 150 Score = 84.0 bits (206), Expect = 4e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG+V+R+EQLKEKDPNVYVLDQFTNPAN +AHFT TG Sbjct: 22 DPKLGFQGMVERIEQLKEKDPNVYVLDQFTNPANLDAHFTGTG 64 >ref|XP_020269729.1| cysteine synthase, chloroplastic/chromoplastic-like isoform X4 [Asparagus officinalis] ref|XP_020269730.1| cysteine synthase, chloroplastic/chromoplastic-like isoform X4 [Asparagus officinalis] Length = 274 Score = 86.3 bits (212), Expect = 1e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG VDR+EQLKE DPNVYVLDQFTNPANPEAHFT TG Sbjct: 73 DPKLGFQGQVDRIEQLKETDPNVYVLDQFTNPANPEAHFTCTG 115 >ref|XP_020269728.1| cysteine synthase, chloroplastic/chromoplastic-like isoform X3 [Asparagus officinalis] Length = 283 Score = 86.3 bits (212), Expect = 1e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG VDR+EQLKE DPNVYVLDQFTNPANPEAHFT TG Sbjct: 82 DPKLGFQGQVDRIEQLKETDPNVYVLDQFTNPANPEAHFTCTG 124 >gb|ONK66579.1| uncharacterized protein A4U43_C06F9820 [Asparagus officinalis] Length = 184 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG+V+R+EQLKEKD NVYVLDQF+NPANP+AHFT TG Sbjct: 40 DPKLGFQGMVERIEQLKEKDSNVYVLDQFSNPANPDAHFTGTG 82 >ref|XP_020269726.1| cysteine synthase-like isoform X1 [Asparagus officinalis] gb|ONK66586.1| uncharacterized protein A4U43_C06F9900 [Asparagus officinalis] Length = 340 Score = 86.3 bits (212), Expect = 3e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG VDR+EQLKE DPNVYVLDQFTNPANPEAHFT TG Sbjct: 139 DPKLGFQGQVDRIEQLKETDPNVYVLDQFTNPANPEAHFTCTG 181 >ref|XP_009388576.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis] ref|XP_018674729.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis] Length = 340 Score = 85.9 bits (211), Expect = 4e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQGLVDR+EQLKEK PNV+VLDQFTNPANPEAHFT TG Sbjct: 140 DPKLGFQGLVDRIEQLKEKIPNVHVLDQFTNPANPEAHFTGTG 182 >gb|ONK55670.1| uncharacterized protein A4U43_UnF330 [Asparagus officinalis] Length = 295 Score = 84.0 bits (206), Expect = 8e-14 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG+V+R+EQLKEKDPNVYVLDQFTNPAN +AHFT TG Sbjct: 23 DPKLGFQGMVERIEQLKEKDPNVYVLDQFTNPANLDAHFTGTG 65 >gb|ONK66585.1| uncharacterized protein A4U43_C06F9890 [Asparagus officinalis] Length = 269 Score = 83.2 bits (204), Expect = 1e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPK GFQG+V+R+EQLKE DPNVYVLDQFTNPANP+AHFT TG Sbjct: 68 DPKHGFQGMVERIEQLKENDPNVYVLDQFTNPANPDAHFTGTG 110 >ref|XP_020271252.1| bifunctional cystathionine gamma-lyase/cysteine synthase-like [Asparagus officinalis] Length = 340 Score = 83.2 bits (204), Expect = 3e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPK GFQG+V+R+EQLKE DPNVYVLDQFTNPANP+AHFT TG Sbjct: 139 DPKHGFQGMVERIEQLKENDPNVYVLDQFTNPANPDAHFTGTG 181 >ref|XP_020587742.1| cysteine synthase-like [Phalaenopsis equestris] Length = 354 Score = 77.4 bits (189), Expect = 3e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLG +G+ DRV+QLKEKDPN++VLDQ TNPANPEAHF STG Sbjct: 154 DPKLGIKGIYDRVDQLKEKDPNMFVLDQTTNPANPEAHFLSTG 196 >ref|XP_010915296.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform X3 [Elaeis guineensis] Length = 317 Score = 75.5 bits (184), Expect = 8e-11 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG DRVEQLKE PNVYVLDQ TN ANPEAH+T TG Sbjct: 117 DPKLGFQGASDRVEQLKENIPNVYVLDQLTNAANPEAHYTGTG 159 >ref|XP_010915295.1| PREDICTED: cysteine synthase isoform X2 [Elaeis guineensis] Length = 347 Score = 75.5 bits (184), Expect = 1e-10 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG DRVEQLKE PNVYVLDQ TN ANPEAH+T TG Sbjct: 147 DPKLGFQGASDRVEQLKENIPNVYVLDQLTNAANPEAHYTGTG 189 >ref|XP_019704868.1| PREDICTED: cysteine synthase isoform X1 [Elaeis guineensis] Length = 368 Score = 75.5 bits (184), Expect = 1e-10 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQG DRVEQLKE PNVYVLDQ TN ANPEAH+T TG Sbjct: 168 DPKLGFQGASDRVEQLKENIPNVYVLDQLTNAANPEAHYTGTG 210 >ref|XP_010915297.1| PREDICTED: cysteine synthase-like [Elaeis guineensis] Length = 345 Score = 75.1 bits (183), Expect = 1e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLGFQGL+DRV+QLKE PN +VLDQF N ANPEAHFT TG Sbjct: 145 DPKLGFQGLLDRVKQLKENIPNAHVLDQFANAANPEAHFTGTG 187 >ref|XP_020100781.1| cysteine synthase-like [Ananas comosus] Length = 344 Score = 73.6 bits (179), Expect = 4e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DP L FQGLVD+VEQLK++ PNVYVLDQFTN ANPEAHF TG Sbjct: 144 DPLLAFQGLVDKVEQLKKEIPNVYVLDQFTNAANPEAHFRGTG 186 >ref|XP_020100056.1| cysteine synthase-like [Ananas comosus] ref|XP_020100057.1| cysteine synthase-like [Ananas comosus] Length = 349 Score = 72.8 bits (177), Expect = 8e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DP LGFQG V++VEQLK++ PNVYVLDQFTN ANPEAHF TG Sbjct: 149 DPSLGFQGQVEKVEQLKKEIPNVYVLDQFTNTANPEAHFKGTG 191 >gb|OAY85500.1| Cysteine synthase, chloroplastic/chromoplastic [Ananas comosus] Length = 705 Score = 73.6 bits (179), Expect = 1e-09 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DP L FQGLVD+VEQLK++ PNVYVLDQFTN ANPEAHF TG Sbjct: 144 DPLLAFQGLVDKVEQLKKEIPNVYVLDQFTNAANPEAHFRGTG 186 >ref|XP_020702204.1| cysteine synthase-like [Dendrobium catenatum] gb|PKU82364.1| Cysteine synthase [Dendrobium catenatum] Length = 338 Score = 70.9 bits (172), Expect = 3e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DPKLG + + V+QLKEKDPN++VLDQ TNPANPEAHF STG Sbjct: 138 DPKLGIKAIYTTVDQLKEKDPNIFVLDQTTNPANPEAHFLSTG 180 >ref|XP_020087943.1| cysteine synthase-like [Ananas comosus] Length = 339 Score = 69.7 bits (169), Expect = 7e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DP LGF+G+ DR+E+LK++ PNV+VL+QFTNPANPEAHF TG Sbjct: 139 DPALGFKGIFDRIEELKKEIPNVHVLNQFTNPANPEAHFRWTG 181 >gb|OAY83965.1| Bifunctional L-3-cyanoalanine synthase/cysteine synthase D1, partial [Ananas comosus] Length = 347 Score = 69.7 bits (169), Expect = 8e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +1 Query: 1 DPKLGFQGLVDRVEQLKEKDPNVYVLDQFTNPANPEAHFTSTG 129 DP LGF+G+ DR+E+LK++ PNV+VL+QFTNPANPEAHF TG Sbjct: 154 DPALGFKGIFDRIEELKKEIPNVHVLNQFTNPANPEAHFRWTG 196