BLASTX nr result
ID: Ophiopogon22_contig00003722
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00003722 (628 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK79349.1| uncharacterized protein A4U43_C01F5460 [Asparagus... 60 3e-07 ref|XP_020253210.1| cell division control protein 48 homolog C-l... 60 6e-07 ref|XP_020274402.1| cell division control protein 48 homolog C-l... 60 6e-07 >gb|ONK79349.1| uncharacterized protein A4U43_C01F5460 [Asparagus officinalis] Length = 293 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 5/62 (8%) Frame = -3 Query: 626 ALINEAKMIAREEAW-----ESGNTKEVVIETSHLEKALVKIPRSVSEKQKLYYETQSEN 462 AL+NEA M A EE S T+ +VIETSH EKALVK+ SVSEKQ++YYE S + Sbjct: 230 ALMNEAAMAALEEKQMTSEDNSSFTRPLVIETSHFEKALVKVGPSVSEKQRIYYEALSRS 289 Query: 461 YR 456 +R Sbjct: 290 HR 291 >ref|XP_020253210.1| cell division control protein 48 homolog C-like [Asparagus officinalis] Length = 781 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 5/62 (8%) Frame = -3 Query: 626 ALINEAKMIAREEAW-----ESGNTKEVVIETSHLEKALVKIPRSVSEKQKLYYETQSEN 462 AL+NEA M A EE S T+ +VIETSH EKALVK+ SVSEKQ++YYE S + Sbjct: 718 ALMNEAAMAALEEKQMTSEDNSSFTRPLVIETSHFEKALVKVGPSVSEKQRIYYEALSRS 777 Query: 461 YR 456 +R Sbjct: 778 HR 779 >ref|XP_020274402.1| cell division control protein 48 homolog C-like [Asparagus officinalis] Length = 789 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 5/62 (8%) Frame = -3 Query: 626 ALINEAKMIAREEAW-----ESGNTKEVVIETSHLEKALVKIPRSVSEKQKLYYETQSEN 462 AL+NEA M A EE S T+ +VIETSH EKALVK+ SVSEKQ++YYE S + Sbjct: 726 ALMNEAAMAALEEKQMTLEDSSSFTRPLVIETSHFEKALVKVGPSVSEKQRIYYEALSRS 785 Query: 461 YR 456 +R Sbjct: 786 HR 787