BLASTX nr result
ID: Ophiopogon22_contig00003698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00003698 (1993 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OWB80464.1| hypothetical protein B5S32_g4743 [[Candida] boidi... 60 7e-06 >gb|OWB80464.1| hypothetical protein B5S32_g4743 [[Candida] boidinii] Length = 1417 Score = 60.5 bits (145), Expect(2) = 7e-06 Identities = 42/103 (40%), Positives = 54/103 (52%), Gaps = 4/103 (3%) Frame = +2 Query: 1628 SHGSPNE*TNT---AHHP*YHRSSDGLQKSVHHRDTIHHRMED-KSTHHP*HHRLPDGRQ 1795 SH P+ +++ +HHP +H SS KS HH HH KS+HHP HH Sbjct: 907 SHHPPHHTSSSVKSSHHPPHHTSSS--VKSSHHPP--HHTSSSVKSSHHPPHH--TSSSV 960 Query: 1796 KSIYYP*YHTLPDGKRKSIHHP*YHTSPDG*TKSTHHP*HRRS 1924 KS ++P +HT KS HHP +HTS KS+HHP H S Sbjct: 961 KSSHHPPHHT--SSSVKSSHHPPHHTSSS--VKSSHHPPHHTS 999 Score = 20.4 bits (41), Expect(2) = 7e-06 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 1923 HRMDRRKLIHHP*YHTS 1973 H K HHP +HTS Sbjct: 997 HTSSSVKSSHHPPHHTS 1013