BLASTX nr result
ID: Ophiopogon22_contig00001821
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00001821 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007162753.1| hypothetical protein PHAVU_001G177600g [Phas... 53 5e-07 >ref|XP_007162753.1| hypothetical protein PHAVU_001G177600g [Phaseolus vulgaris] gb|ESW34747.1| hypothetical protein PHAVU_001G177600g [Phaseolus vulgaris] Length = 50 Score = 52.8 bits (125), Expect = 5e-07 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 151 MGFVVVISLPFIILVAILAAVCYMLGRAH-RRRTPLVYG 264 MGFVVVISLP I+ + ILA VCYMLGRA RR+ P YG Sbjct: 1 MGFVVVISLPLILFILILALVCYMLGRAKGRRQNPQQYG 39