BLASTX nr result
ID: Ophiopogon22_contig00000463
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00000463 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251273.1| peptidyl-prolyl cis-trans isomerase CYP95-li... 119 2e-28 ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 119 2e-28 ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 117 7e-28 ref|XP_010914921.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 114 9e-27 ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 114 9e-27 ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 114 9e-27 ref|XP_020087995.1| peptidyl-prolyl cis-trans isomerase CYP95 [A... 114 1e-26 ref|XP_021275810.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 113 2e-26 ref|XP_021275807.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 113 2e-26 ref|XP_021275806.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 113 2e-26 ref|XP_021275805.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 113 2e-26 ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 112 6e-26 gb|OVA00494.1| Cyclophilin-like peptidyl-prolyl cis-trans isomer... 111 1e-25 dbj|GAV70565.1| Pro_isomerase domain-containing protein [Cephalo... 111 1e-25 gb|EOY31440.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 110 2e-25 gb|EOY31437.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 110 3e-25 ref|XP_017983288.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 110 3e-25 ref|XP_010546571.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 110 3e-25 gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 110 3e-25 ref|XP_007013817.2| PREDICTED: peptidyl-prolyl cis-trans isomera... 110 3e-25 >ref|XP_020251273.1| peptidyl-prolyl cis-trans isomerase CYP95-like [Asparagus officinalis] gb|ONK81011.1| uncharacterized protein A4U43_C01F24280 [Asparagus officinalis] Length = 823 Score = 119 bits (299), Expect = 2e-28 Identities = 62/102 (60%), Positives = 68/102 (66%) Frame = -3 Query: 381 PIRDARKSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRALSPPSNRGRSLSRSASP 202 P+RDAR+SL RALSPPSNRGRS SRSASP Sbjct: 586 PVRDARRSLSRSPVRSSRRSASRSPVRRRTRRSISRSPVSRRALSPPSNRGRSFSRSASP 645 Query: 201 DGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGRT 76 DGSPKRI+RGRGFS++YSYARRYRT SPDRSP+RSHRYGGRT Sbjct: 646 DGSPKRIQRGRGFSEKYSYARRYRTRSPDRSPIRSHRYGGRT 687 >ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] Length = 842 Score = 119 bits (298), Expect = 2e-28 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -3 Query: 255 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 ALSPPSN GRSLSRSASPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGGR Sbjct: 630 ALSPPSNHGRSLSRSASPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGGR 688 >ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] ref|XP_017697447.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] Length = 818 Score = 117 bits (294), Expect = 7e-28 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -3 Query: 255 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 ALSPPSN GRSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGGR Sbjct: 606 ALSPPSNHGRSLSRSTSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGGR 664 >ref|XP_010914921.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Elaeis guineensis] Length = 726 Score = 114 bits (286), Expect = 9e-27 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -3 Query: 255 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 A+SPPSN RSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGGR Sbjct: 516 AISPPSNHNRSLSRSVSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGGR 574 >ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Musa acuminata subsp. malaccensis] Length = 819 Score = 114 bits (286), Expect = 9e-27 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -3 Query: 255 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGRT 76 A+SPPSN RSLSRSASPDGSPKRIRRGRGFSQ+YSYARRYRTPSPDRSP+R HRYGGR+ Sbjct: 613 AISPPSNHRRSLSRSASPDGSPKRIRRGRGFSQQYSYARRYRTPSPDRSPIRLHRYGGRS 672 >ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Elaeis guineensis] Length = 836 Score = 114 bits (286), Expect = 9e-27 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -3 Query: 255 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 A+SPPSN RSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGGR Sbjct: 626 AISPPSNHNRSLSRSVSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGGR 684 >ref|XP_020087995.1| peptidyl-prolyl cis-trans isomerase CYP95 [Ananas comosus] ref|XP_020087996.1| peptidyl-prolyl cis-trans isomerase CYP95 [Ananas comosus] gb|OAY82935.1| Peptidyl-prolyl cis-trans isomerase CYP63 [Ananas comosus] Length = 826 Score = 114 bits (285), Expect = 1e-26 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = -3 Query: 255 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGRT 76 A+SPP NRGRSLSRS SPDGSPKRIRRGRGFSQRYSYARRYRTPSP+RSPVRS+R+GGR+ Sbjct: 619 AVSPPVNRGRSLSRSGSPDGSPKRIRRGRGFSQRYSYARRYRTPSPERSPVRSYRFGGRS 678 >ref|XP_021275810.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Herrania umbratica] ref|XP_021275811.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Herrania umbratica] Length = 723 Score = 113 bits (283), Expect = 2e-26 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRSPVRS+RYGGR Sbjct: 526 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGGR 582 >ref|XP_021275807.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] ref|XP_021275808.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] ref|XP_021275809.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] Length = 833 Score = 113 bits (283), Expect = 2e-26 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRSPVRS+RYGGR Sbjct: 636 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGGR 692 >ref|XP_021275806.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Herrania umbratica] Length = 843 Score = 113 bits (283), Expect = 2e-26 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRSPVRS+RYGGR Sbjct: 646 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGGR 702 >ref|XP_021275805.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Herrania umbratica] Length = 848 Score = 113 bits (283), Expect = 2e-26 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRSPVRS+RYGGR Sbjct: 651 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGGR 707 >ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Musa acuminata subsp. malaccensis] Length = 832 Score = 112 bits (280), Expect = 6e-26 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -3 Query: 255 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 A SPPSNR RSLSRS SPDGSPKRIRRGRGFSQ+YS+ARRYRTPSPDRSPVR HRYGGR Sbjct: 610 AASPPSNRRRSLSRSVSPDGSPKRIRRGRGFSQQYSFARRYRTPSPDRSPVRLHRYGGR 668 >gb|OVA00494.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain [Macleaya cordata] Length = 811 Score = 111 bits (278), Expect = 1e-25 Identities = 55/58 (94%), Positives = 56/58 (96%), Gaps = 1/58 (1%) Frame = -3 Query: 249 SPPSN-RGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SP SN RGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSP+RSPVRSHRYGGR Sbjct: 621 SPVSNHRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPERSPVRSHRYGGR 678 >dbj|GAV70565.1| Pro_isomerase domain-containing protein [Cephalotus follicularis] Length = 784 Score = 111 bits (277), Expect = 1e-25 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPS+ GRSLSRS SPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRS+RY GR Sbjct: 596 SPPSDHGRSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSYRYSGR 652 >gb|EOY31440.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 5, partial [Theobroma cacao] Length = 579 Score = 110 bits (275), Expect = 2e-25 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGGR Sbjct: 380 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGGR 436 >gb|EOY31437.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 2 [Theobroma cacao] Length = 733 Score = 110 bits (275), Expect = 3e-25 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGGR Sbjct: 532 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGGR 588 >ref|XP_017983288.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Theobroma cacao] ref|XP_017983289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Theobroma cacao] Length = 735 Score = 110 bits (275), Expect = 3e-25 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGGR Sbjct: 532 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGGR 588 >ref|XP_010546571.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Tarenaya hassleriana] Length = 735 Score = 110 bits (275), Expect = 3e-25 Identities = 52/57 (91%), Positives = 53/57 (92%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPS+R RSLSRS SPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSP RSHRYG R Sbjct: 548 SPPSDRRRSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPARSHRYGDR 604 >gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma cacao] gb|EOY31438.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma cacao] Length = 843 Score = 110 bits (275), Expect = 3e-25 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGGR Sbjct: 642 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGGR 698 >ref|XP_007013817.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Theobroma cacao] ref|XP_017983287.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Theobroma cacao] Length = 845 Score = 110 bits (275), Expect = 3e-25 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -3 Query: 249 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGR 79 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGGR Sbjct: 642 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGGR 698