BLASTX nr result
ID: Ophiopogon22_contig00000152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00000152 (532 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDW75723.1| UNKNOWN [Stylonychia lemnae] 57 3e-06 emb|SBT58227.1| hypothetical protein POVWA1_086370 [Plasmodium o... 54 5e-06 gb|ETW45730.1| hypothetical protein PFMALIP_06208, partial [Plas... 52 5e-06 gb|EMC20828.1| hypothetical protein SMU82_09667, partial [Strept... 52 6e-06 emb|CDS30781.1| expressed protein [Hymenolepis microstoma] >gi|9... 54 7e-06 gb|EJY66653.1| hypothetical protein OXYTRI_13058 (macronuclear) ... 56 8e-06 gb|EJY65597.1| hypothetical protein OXYTRI_14248 (macronuclear) ... 56 8e-06 >emb|CDW75723.1| UNKNOWN [Stylonychia lemnae] Length = 1881 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 88 GQWESR*SIHARH*LDDEAFGYLKRVIVT 2 GQWESR SIHARH LDDEAFGYLKRVIVT Sbjct: 287 GQWESRQSIHARHQLDDEAFGYLKRVIVT 315 >emb|SBT58227.1| hypothetical protein POVWA1_086370 [Plasmodium ovale wallikeri] emb|SBT59203.1| hypothetical protein POVWA2_093110 [Plasmodium ovale wallikeri] Length = 148 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +1 Query: 22 GSQMPRHLISDAHEWINEIPTVPS 93 GSQMPRHLISDAHEWINEIPTVP+ Sbjct: 12 GSQMPRHLISDAHEWINEIPTVPT 35 >gb|ETW45730.1| hypothetical protein PFMALIP_06208, partial [Plasmodium falciparum MaliPS096_E11] gb|EUR55615.1| hypothetical protein PFBG_06032, partial [Plasmodium falciparum 7G8] Length = 57 Score = 52.0 bits (123), Expect = 5e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 25 SQMPRHLISDAHEWINEIPTVPS 93 SQMPRHLISDAHEWINEIPTVP+ Sbjct: 1 SQMPRHLISDAHEWINEIPTVPT 23 >gb|EMC20828.1| hypothetical protein SMU82_09667, partial [Streptococcus mutans SM6] Length = 51 Score = 51.6 bits (122), Expect = 6e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +1 Query: 25 SQMPRHLISDAHEWINEIPTVP 90 SQMPRHLISDAHEWINEIPTVP Sbjct: 1 SQMPRHLISDAHEWINEIPTVP 22 >emb|CDS30781.1| expressed protein [Hymenolepis microstoma] emb|CUU98133.1| hypothetical transcript [Hymenolepis microstoma] Length = 151 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 22 GSQMPRHLISDAHEWINEIPTVP 90 GSQMPRHLISDAHEWINEIPTVP Sbjct: 64 GSQMPRHLISDAHEWINEIPTVP 86 >gb|EJY66653.1| hypothetical protein OXYTRI_13058 (macronuclear) [Oxytricha trifallax] Length = 1367 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 RDSGNLVNPFMRVTN*MTRHLATLRES*LL 1 RDSGNLVNPFMRVTN MTRHLATLRES LL Sbjct: 323 RDSGNLVNPFMRVTNQMTRHLATLRESQLL 352 >gb|EJY65597.1| hypothetical protein OXYTRI_14248 (macronuclear) [Oxytricha trifallax] Length = 1367 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 RDSGNLVNPFMRVTN*MTRHLATLRES*LL 1 RDSGNLVNPFMRVTN MTRHLATLRES LL Sbjct: 323 RDSGNLVNPFMRVTNQMTRHLATLRESQLL 352