BLASTX nr result
ID: Ophiopogon22_contig00000144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00000144 (807 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAN77868.1| putative heterogeneous nuclear ribonucleoprotein,... 88 2e-16 ref|XP_020262932.1| heterogeneous nuclear ribonucleoprotein R [A... 87 1e-15 gb|ONK73431.1| uncharacterized protein A4U43_C04F31420 [Asparagu... 87 1e-15 ref|XP_010052781.1| PREDICTED: nucleolin [Eucalyptus grandis] >g... 87 1e-15 gb|ONK64637.1| uncharacterized protein A4U43_C07F28240 [Asparagu... 87 2e-15 gb|OAY49444.1| hypothetical protein MANES_05G056900 [Manihot esc... 87 2e-15 ref|XP_021613173.1| nucleolin isoform X2 [Manihot esculenta] >gi... 87 2e-15 ref|XP_021613170.1| nucleolin isoform X1 [Manihot esculenta] >gi... 87 2e-15 gb|OWM75111.1| hypothetical protein CDL15_Pgr017237 [Punica gran... 87 2e-15 gb|PKI67830.1| hypothetical protein CRG98_011803 [Punica granatum] 87 2e-15 ref|XP_002270340.2| PREDICTED: nucleolin [Vitis vinifera] >gi|73... 87 2e-15 ref|XP_020272480.1| uncharacterized protein LOC109847661 [Aspara... 87 2e-15 gb|PNT49611.1| hypothetical protein POPTR_002G139700v3 [Populus ... 86 2e-15 ref|XP_022865998.1| nucleolin-like [Olea europaea var. sylvestri... 86 3e-15 ref|XP_008794874.1| PREDICTED: nucleolin [Phoenix dactylifera] >... 86 3e-15 ref|XP_002302501.2| hypothetical protein POPTR_0002s14050g [Popu... 86 3e-15 ref|XP_021641035.1| heterogeneous nuclear ribonucleoprotein Q-li... 86 3e-15 ref|XP_021641031.1| heterogeneous nuclear ribonucleoprotein Q-li... 86 3e-15 ref|XP_019705539.1| PREDICTED: nucleolin isoform X2 [Elaeis guin... 86 3e-15 ref|XP_011017400.1| PREDICTED: nucleolin-like isoform X2 [Populu... 86 3e-15 >gb|AAN77868.1| putative heterogeneous nuclear ribonucleoprotein, partial [Vitis vinifera] Length = 342 Score = 87.8 bits (216), Expect = 2e-16 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDLKKVFS VGE+TEVRLMMNP Sbjct: 22 FKERRKRKEFEVFVGGLDKDATEDDLKKVFSQVGEVTEVRLMMNP 66 >ref|XP_020262932.1| heterogeneous nuclear ribonucleoprotein R [Asparagus officinalis] ref|XP_020262933.1| heterogeneous nuclear ribonucleoprotein R [Asparagus officinalis] ref|XP_020262934.1| heterogeneous nuclear ribonucleoprotein R [Asparagus officinalis] ref|XP_020262935.1| heterogeneous nuclear ribonucleoprotein R [Asparagus officinalis] Length = 736 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 133 KEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 KEHRKRKEFE+FVGGLDKDATEDDL+KVFS +GEITEVRLMMNP Sbjct: 154 KEHRKRKEFEIFVGGLDKDATEDDLRKVFSAIGEITEVRLMMNP 197 >gb|ONK73431.1| uncharacterized protein A4U43_C04F31420 [Asparagus officinalis] Length = 838 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 133 KEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 KEHRKRKEFE+FVGGLDKDATEDDL+KVFS +GEITEVRLMMNP Sbjct: 256 KEHRKRKEFEIFVGGLDKDATEDDLRKVFSAIGEITEVRLMMNP 299 >ref|XP_010052781.1| PREDICTED: nucleolin [Eucalyptus grandis] ref|XP_010052782.1| PREDICTED: nucleolin [Eucalyptus grandis] gb|KCW76850.1| hypothetical protein EUGRSUZ_D01204 [Eucalyptus grandis] gb|KCW76851.1| hypothetical protein EUGRSUZ_D01204 [Eucalyptus grandis] Length = 793 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+KVFS VGE+TEVRLMMNP Sbjct: 204 FKERRKRKEFEVFVGGLDKDATEDDLRKVFSAVGEVTEVRLMMNP 248 >gb|ONK64637.1| uncharacterized protein A4U43_C07F28240 [Asparagus officinalis] Length = 723 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -3 Query: 133 KEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 KEHRKRKEFEVFVGGLDKDATEDDL+KVFS GEITEVRLMMNP Sbjct: 120 KEHRKRKEFEVFVGGLDKDATEDDLRKVFSAAGEITEVRLMMNP 163 >gb|OAY49444.1| hypothetical protein MANES_05G056900 [Manihot esculenta] Length = 765 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDAT+DDLKKVFS VGE+TEVRLMMNP Sbjct: 204 FKERRKRKEFEVFVGGLDKDATQDDLKKVFSRVGEVTEVRLMMNP 248 >ref|XP_021613173.1| nucleolin isoform X2 [Manihot esculenta] gb|OAY49446.1| hypothetical protein MANES_05G056900 [Manihot esculenta] Length = 777 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDAT+DDLKKVFS VGE+TEVRLMMNP Sbjct: 204 FKERRKRKEFEVFVGGLDKDATQDDLKKVFSRVGEVTEVRLMMNP 248 >ref|XP_021613170.1| nucleolin isoform X1 [Manihot esculenta] ref|XP_021613171.1| nucleolin isoform X1 [Manihot esculenta] ref|XP_021613172.1| nucleolin isoform X1 [Manihot esculenta] gb|OAY49445.1| hypothetical protein MANES_05G056900 [Manihot esculenta] Length = 780 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDAT+DDLKKVFS VGE+TEVRLMMNP Sbjct: 204 FKERRKRKEFEVFVGGLDKDATQDDLKKVFSRVGEVTEVRLMMNP 248 >gb|OWM75111.1| hypothetical protein CDL15_Pgr017237 [Punica granatum] Length = 797 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+KVFS VGE+TE+RLMMNP Sbjct: 213 FKERRKRKEFEVFVGGLDKDATEDDLRKVFSAVGEVTEIRLMMNP 257 >gb|PKI67830.1| hypothetical protein CRG98_011803 [Punica granatum] Length = 800 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+KVFS VGE+TE+RLMMNP Sbjct: 213 FKERRKRKEFEVFVGGLDKDATEDDLRKVFSAVGEVTEIRLMMNP 257 >ref|XP_002270340.2| PREDICTED: nucleolin [Vitis vinifera] ref|XP_010661414.1| PREDICTED: nucleolin [Vitis vinifera] emb|CBI16691.3| unnamed protein product, partial [Vitis vinifera] Length = 812 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+KVFS VGE+TEVRLMMNP Sbjct: 223 FKERRKRKEFEVFVGGLDKDATEDDLRKVFSQVGEVTEVRLMMNP 267 >ref|XP_020272480.1| uncharacterized protein LOC109847661 [Asparagus officinalis] Length = 932 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -3 Query: 133 KEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 KEHRKRKEFEVFVGGLDKDATEDDL+KVFS GEITEVRLMMNP Sbjct: 329 KEHRKRKEFEVFVGGLDKDATEDDLRKVFSAAGEITEVRLMMNP 372 >gb|PNT49611.1| hypothetical protein POPTR_002G139700v3 [Populus trichocarpa] Length = 618 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+K+FS VGE+TEVRLMMNP Sbjct: 201 FKERRKRKEFEVFVGGLDKDATEDDLRKIFSRVGEVTEVRLMMNP 245 >ref|XP_022865998.1| nucleolin-like [Olea europaea var. sylvestris] ref|XP_022866003.1| nucleolin-like [Olea europaea var. sylvestris] Length = 776 Score = 86.3 bits (212), Expect = 3e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFE+FVGGLDKDATEDDL+KVFS VGE+TEVRLMMNP Sbjct: 185 FKERRKRKEFEIFVGGLDKDATEDDLRKVFSEVGEVTEVRLMMNP 229 >ref|XP_008794874.1| PREDICTED: nucleolin [Phoenix dactylifera] ref|XP_008794875.1| PREDICTED: nucleolin [Phoenix dactylifera] Length = 780 Score = 86.3 bits (212), Expect = 3e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 133 KEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 KEH+KRKEFEVFVGGLDKDATEDDL+KVFS VGE+TEVRLMMNP Sbjct: 191 KEHQKRKEFEVFVGGLDKDATEDDLRKVFSVVGEVTEVRLMMNP 234 >ref|XP_002302501.2| hypothetical protein POPTR_0002s14050g [Populus trichocarpa] Length = 784 Score = 86.3 bits (212), Expect = 3e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+K+FS VGE+TEVRLMMNP Sbjct: 201 FKERRKRKEFEVFVGGLDKDATEDDLRKIFSRVGEVTEVRLMMNP 245 >ref|XP_021641035.1| heterogeneous nuclear ribonucleoprotein Q-like isoform X2 [Hevea brasiliensis] ref|XP_021641036.1| heterogeneous nuclear ribonucleoprotein Q-like isoform X2 [Hevea brasiliensis] Length = 785 Score = 86.3 bits (212), Expect = 3e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+KVFS VGE+TEVRLMMNP Sbjct: 208 FKERRKRKEFEVFVGGLDKDATEDDLQKVFSRVGEVTEVRLMMNP 252 >ref|XP_021641031.1| heterogeneous nuclear ribonucleoprotein Q-like isoform X1 [Hevea brasiliensis] ref|XP_021641032.1| heterogeneous nuclear ribonucleoprotein Q-like isoform X1 [Hevea brasiliensis] ref|XP_021641034.1| heterogeneous nuclear ribonucleoprotein Q-like isoform X1 [Hevea brasiliensis] Length = 788 Score = 86.3 bits (212), Expect = 3e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+KVFS VGE+TEVRLMMNP Sbjct: 208 FKERRKRKEFEVFVGGLDKDATEDDLQKVFSRVGEVTEVRLMMNP 252 >ref|XP_019705539.1| PREDICTED: nucleolin isoform X2 [Elaeis guineensis] Length = 790 Score = 86.3 bits (212), Expect = 3e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 133 KEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 KEHRKRKEFEVFVGGLDKDAT+DDL+KVFS VGE+TEVRLMMNP Sbjct: 201 KEHRKRKEFEVFVGGLDKDATDDDLRKVFSEVGEVTEVRLMMNP 244 >ref|XP_011017400.1| PREDICTED: nucleolin-like isoform X2 [Populus euphratica] Length = 791 Score = 86.3 bits (212), Expect = 3e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 136 FKEHRKRKEFEVFVGGLDKDATEDDLKKVFSTVGEITEVRLMMNP 2 FKE RKRKEFEVFVGGLDKDATEDDL+K+FS VGE+TEVRLMMNP Sbjct: 203 FKERRKRKEFEVFVGGLDKDATEDDLRKIFSRVGEVTEVRLMMNP 247