BLASTX nr result
ID: Ophiopogon22_contig00000085
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00000085 (580 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021372048.1| mucin-2-like [Mizuhopecten yessoensis] 57 7e-06 >ref|XP_021372048.1| mucin-2-like [Mizuhopecten yessoensis] Length = 2905 Score = 56.6 bits (135), Expect = 7e-06 Identities = 42/119 (35%), Positives = 56/119 (47%) Frame = -1 Query: 388 TSQNTTPQT*TLHRPSKHNNPSTANSLQELQFQKIHRYNTLAPEHQHNTITPTTKHNTPS 209 T+ TTP T T P+ PST N+L NTL+ + T TPTT TPS Sbjct: 1024 TTTTTTPSTATT--PTTSTTPSTINTLSTT--------NTLSTTNTPTTTTPTTTTTTPS 1073 Query: 208 QDTTLHINTIRITLQLLKYRTIHNSSNIKATITAPDTSTTPQTQRHSHPNSTTISNNDT 32 DTT +T T+ L +++N T T P T+TTP + + STT S +T Sbjct: 1074 TDTTPTTSTTPSTINTLSTTNTLSTTNTPTT-TTPTTTTTPPSTATTPTTSTTPSTINT 1131