BLASTX nr result
ID: Ophiopogon22_contig00000069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00000069 (833 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI79430.1| hypothetical protein CRG98_000177 [Punica granatum] 58 6e-06 >gb|PKI79430.1| hypothetical protein CRG98_000177 [Punica granatum] Length = 482 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 279 KEKFEMQDLHVTETLPQMVAFSEAYMHIYKQHR 181 + K+EMQDLHV+ETLPQMVA SEAYM IY+QH+ Sbjct: 450 RSKYEMQDLHVSETLPQMVALSEAYMQIYEQHK 482