BLASTX nr result
ID: Ophiopogon22_contig00000010
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00000010 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK76779.1| uncharacterized protein A4U43_C03F32060 [Asparagu... 59 2e-07 ref|XP_020259177.1| nuclear-pore anchor [Asparagus officinalis] 59 2e-07 >gb|ONK76779.1| uncharacterized protein A4U43_C03F32060 [Asparagus officinalis] Length = 2000 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = +2 Query: 2 PSPSTVATEMDEPAATRGGGRTITIADRAKENAIVRQQSQQARMTATTPP 151 P+ S V TE DE A TR GGRTI+I +RA+ENA +RQ QQARM TPP Sbjct: 1929 PNRSVVPTETDEHAQTRSGGRTISITERARENARLRQ--QQARMNTPTPP 1976 >ref|XP_020259177.1| nuclear-pore anchor [Asparagus officinalis] Length = 2046 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = +2 Query: 2 PSPSTVATEMDEPAATRGGGRTITIADRAKENAIVRQQSQQARMTATTPP 151 P+ S V TE DE A TR GGRTI+I +RA+ENA +RQ QQARM TPP Sbjct: 1975 PNRSVVPTETDEHAQTRSGGRTISITERARENARLRQ--QQARMNTPTPP 2022