BLASTX nr result
ID: Ophiopogon21_contig00042057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042057 (546 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW25757.1| hypothetical protein PV07_08912 [Cladophialophora... 60 6e-07 >gb|KIW25757.1| hypothetical protein PV07_08912 [Cladophialophora immunda] Length = 65 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 305 RSKVQNSLKSTTQYVSRKAKEHHASVTEAYQTFYGLNVP 189 R+KV +S KS TQY+S+KAKEHH V EAY+ +YGLNVP Sbjct: 22 RNKVHSSWKSATQYISQKAKEHHRGVNEAYRAYYGLNVP 60