BLASTX nr result
ID: Ophiopogon21_contig00041977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00041977 (990 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW06683.1| hypothetical protein PV09_02388 [Verruconis gallo... 68 1e-08 ref|XP_007776495.1| hypothetical protein W97_00390 [Coniosporium... 63 4e-07 >gb|KIW06683.1| hypothetical protein PV09_02388 [Verruconis gallopava] Length = 175 Score = 67.8 bits (164), Expect = 1e-08 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 2/65 (3%) Frame = -3 Query: 793 LDKR--TVDPASATASLIAVLPSSILNVALTNQAEATTLIEQAFSTGTPAWFTSLPAEVQ 620 L KR +VDP SA+ ++ +VLPSS+ +A+TN A + + F TGTPAWF+SLP +VQ Sbjct: 19 LQKREASVDPLSASLAVFSVLPSSLQAIAITNPAAVASEVSSEFLTGTPAWFSSLPTDVQ 78 Query: 619 TYFLT 605 +YF++ Sbjct: 79 SYFIS 83 >ref|XP_007776495.1| hypothetical protein W97_00390 [Coniosporium apollinis CBS 100218] gi|494823859|gb|EON61178.1| hypothetical protein W97_00390 [Coniosporium apollinis CBS 100218] Length = 281 Score = 62.8 bits (151), Expect = 4e-07 Identities = 30/65 (46%), Positives = 44/65 (67%) Frame = -3 Query: 799 EKLDKRTVDPASATASLIAVLPSSILNVALTNQAEATTLIEQAFSTGTPAWFTSLPAEVQ 620 + L KR ++ AS + L+ LP S+L +A TN+A A++ I Q F TGTP+W+ +LP EVQ Sbjct: 37 QDLRKRQLNEASVLSVLLTALPPSLLVLAATNEAAASSAILQEFLTGTPSWYQNLPTEVQ 96 Query: 619 TYFLT 605 Y L+ Sbjct: 97 NYLLS 101