BLASTX nr result
ID: Ophiopogon21_contig00041942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00041942 (388 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA08066.1| hypothetical protein GLOINDRAFT_349254 [Rhizophag... 57 7e-06 >gb|ESA08066.1| hypothetical protein GLOINDRAFT_349254 [Rhizophagus irregularis DAOM 181602] gi|595485772|gb|EXX72308.1| hypothetical protein RirG_070500 [Rhizophagus irregularis DAOM 197198w] gi|595489308|gb|EXX73837.1| hypothetical protein RirG_056730 [Rhizophagus irregularis DAOM 197198w] Length = 245 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/47 (53%), Positives = 35/47 (74%) Frame = -3 Query: 152 KANGTQIRSGFCSSQIQGQIPDTDHMTSTLILFPKNGGTVRANKNFT 12 +ANGTQI +G CS+ QG+IP ++M STLIL+P NG ++ N+ FT Sbjct: 78 QANGTQILTGVCSNTPQGEIPKVENMPSTLILYPDNGDKIKKNEPFT 124