BLASTX nr result
ID: Ophiopogon21_contig00041857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00041857 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845165.1| PREDICTED: ankyrin repeat domain-containing ... 57 7e-06 >ref|XP_006845165.1| PREDICTED: ankyrin repeat domain-containing protein 50 [Amborella trichopoda] gi|548847678|gb|ERN06840.1| hypothetical protein AMTR_s00005p00232410 [Amborella trichopoda] Length = 765 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -2 Query: 130 GGAFKPLKQQVHPVDYEADASQRFVDAVHRGEMKAATDLLADP 2 GG+FK +KQ V PVDYEA+ SQR +DAVH G++K+A +++ DP Sbjct: 10 GGSFKAVKQVV-PVDYEAEVSQRLIDAVHSGDLKSALEIIGDP 51