BLASTX nr result
ID: Ophiopogon21_contig00041821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00041821 (520 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007800168.1| Plasma membrane fusion protein PRM1 [Endocar... 63 7e-08 >ref|XP_007800168.1| Plasma membrane fusion protein PRM1 [Endocarpon pusillum Z07020] gi|539438542|gb|ERF74229.1| Plasma membrane fusion protein PRM1 [Endocarpon pusillum Z07020] Length = 731 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 519 KFGFAGQRDYDNSLRREATRGGHSRVSSHGEVWGDSKR 406 K GFAGQR+YD+SLR+EAT+GGH+RVSSH EV+ D KR Sbjct: 694 KLGFAGQRNYDSSLRKEATKGGHNRVSSHAEVYPDYKR 731