BLASTX nr result
ID: Ophiopogon21_contig00041713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00041713 (341 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA10633.1| hypothetical protein GLOINDRAFT_29219 [Rhizophagu... 79 1e-12 >gb|ESA10633.1| hypothetical protein GLOINDRAFT_29219 [Rhizophagus irregularis DAOM 181602] Length = 794 Score = 79.0 bits (193), Expect = 1e-12 Identities = 44/58 (75%), Positives = 47/58 (81%), Gaps = 4/58 (6%) Frame = -3 Query: 330 LNVDNRQQPGSIVSTSSNNTV-GMLVQH---FDFNSQHHLQDENMMIKSEDNLDFLNY 169 LN+DN QQPGSIV TSSN+TV GMLVQ FDFNSQHHLQDENMMIKSE + LNY Sbjct: 728 LNIDNGQQPGSIVPTSSNDTVAGMLVQQGMRFDFNSQHHLQDENMMIKSE-GISHLNY 784