BLASTX nr result
ID: Ophiopogon21_contig00041660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00041660 (352 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA09300.1| hypothetical protein GLOINDRAFT_30705 [Rhizophagu... 71 3e-10 gb|EMD41727.1| hypothetical protein CERSUDRAFT_79364 [Gelatopori... 57 7e-06 >gb|ESA09300.1| hypothetical protein GLOINDRAFT_30705 [Rhizophagus irregularis DAOM 181602] gi|595453291|gb|EXX60107.1| Moh1p [Rhizophagus irregularis DAOM 197198w] Length = 110 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 184 MGLTYRTYLNGNRIFGCSKCRTHLSTTESIISK 86 MGLTYRTYLNGNRIFGCSKCRTHLSTT+SIISK Sbjct: 1 MGLTYRTYLNGNRIFGCSKCRTHLSTTDSIISK 33 >gb|EMD41727.1| hypothetical protein CERSUDRAFT_79364 [Gelatoporia subvermispora B] Length = 110 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -1 Query: 184 MGLTYRTYLNGNRIFGCSKCRTHLSTTESIISKVSNNKY 68 MG++YR YL+G RI+GCSKCRTHL+T S+IS+ N ++ Sbjct: 1 MGMSYRRYLHGARIYGCSKCRTHLATIHSMISRAFNGQH 39