BLASTX nr result
ID: Ophiopogon21_contig00041537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00041537 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW64506.1| hypothetical protein PV04_09434 [Capronia semiimm... 62 2e-07 >gb|KIW64506.1| hypothetical protein PV04_09434 [Capronia semiimmersa] Length = 94 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 332 ELRPTTETLTPAGIYSPIIKQGHLFGRKQXXXXXXXSQAQLTKA 201 ELRPTTETLTPAG+YSP +KQGHLF RKQ ++ +LTKA Sbjct: 51 ELRPTTETLTPAGLYSPAMKQGHLFSRKQSTASSTSAKVELTKA 94