BLASTX nr result
ID: Ophiopogon21_contig00025968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00025968 (337 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216245.1| hypothetical protein PRUPE_ppa016948mg [Prun... 57 7e-06 >ref|XP_007216245.1| hypothetical protein PRUPE_ppa016948mg [Prunus persica] gi|462412395|gb|EMJ17444.1| hypothetical protein PRUPE_ppa016948mg [Prunus persica] Length = 407 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = +1 Query: 10 LEDIREVGKYDWGGQAMAALYLSLDACSRQRVKTFNGPWQVLEV 141 LE + ++GKYDWGG A+A LY SLD+CSR R + G W+ EV Sbjct: 168 LEIVSDIGKYDWGGAALACLYRSLDSCSRGRSSSMGGYWRAWEV 211