BLASTX nr result
ID: Ophiopogon21_contig00025409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00025409 (434 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008797204.1| PREDICTED: uncharacterized protein LOC103712... 57 7e-06 >ref|XP_008797204.1| PREDICTED: uncharacterized protein LOC103712454 [Phoenix dactylifera] Length = 696 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/45 (71%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 173 MASAKNEGFLTDEQREVLKIAVQNAEVHSSLLESPRN-LHSEHNS 42 MAS K EGFLTDEQREVLKIA QNAEV SS SP + L SEH++ Sbjct: 1 MASPKKEGFLTDEQREVLKIAAQNAEVLSSSPRSPTSLLFSEHHN 45