BLASTX nr result
ID: Ophiopogon21_contig00025174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00025174 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010935414.1| PREDICTED: F-box protein SKIP23-like [Elaeis... 57 5e-06 >ref|XP_010935414.1| PREDICTED: F-box protein SKIP23-like [Elaeis guineensis] Length = 386 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/67 (41%), Positives = 36/67 (53%) Frame = -3 Query: 374 DPNTGVRSFFNPATGKLSTFDFPECRNKYVGGSAHGWXXXXXXXXXXXLWNPITRAQIPL 195 DPN G SF++P+ KL +F FPE + GS+HGW L NP TR +I L Sbjct: 56 DPNAGTLSFYSPSDDKLHSFSFPEATSTVFCGSSHGWLLLMDQAASISLLNPFTRKRIHL 115 Query: 194 PPPTQFL 174 PP + L Sbjct: 116 PPADEEL 122