BLASTX nr result
ID: Ophiopogon21_contig00024790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00024790 (390 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828233.2| PREDICTED: uncharacterized protein LOC184235... 59 1e-06 gb|ERM95649.1| hypothetical protein AMTR_s00023p00182890 [Ambore... 59 1e-06 >ref|XP_006828233.2| PREDICTED: uncharacterized protein LOC18423569 [Amborella trichopoda] Length = 1232 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -3 Query: 355 GTSSTKKWKRPRKDFMEPSDLDATNDVSYQGNGDLSEIGPSAGFD 221 GTSSTKKWKR +KD EPSD+ NDV YQG GD G S G+D Sbjct: 1099 GTSSTKKWKRQKKDGTEPSDMGNVNDVGYQGIGDQVAGGSSMGYD 1143 >gb|ERM95649.1| hypothetical protein AMTR_s00023p00182890 [Amborella trichopoda] Length = 1343 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -3 Query: 355 GTSSTKKWKRPRKDFMEPSDLDATNDVSYQGNGDLSEIGPSAGFD 221 GTSSTKKWKR +KD EPSD+ NDV YQG GD G S G+D Sbjct: 1210 GTSSTKKWKRQKKDGTEPSDMGNVNDVGYQGIGDQVAGGSSMGYD 1254