BLASTX nr result
ID: Ophiopogon21_contig00013329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00013329 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025554.1| Uncharacterized protein TCM_029816 [Theobrom... 76 9e-12 gb|KMT04609.1| hypothetical protein BVRB_8g182630 [Beta vulgaris... 64 4e-08 gb|ABR16782.1| unknown [Picea sitchensis] 58 2e-06 ref|XP_002509440.1| pentatricopeptide repeat-containing protein,... 57 7e-06 >ref|XP_007025554.1| Uncharacterized protein TCM_029816 [Theobroma cacao] gi|508780920|gb|EOY28176.1| Uncharacterized protein TCM_029816 [Theobroma cacao] Length = 44 Score = 76.3 bits (186), Expect = 9e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 277 FVIGCTGVVMFLHGANFFFHYLSNHFAVRSLSFLGFAGW 161 FV+GCTGVV+FLHGANFFFH LS H AVRSLSFLGF GW Sbjct: 6 FVLGCTGVVVFLHGANFFFHILSQHLAVRSLSFLGFVGW 44 >gb|KMT04609.1| hypothetical protein BVRB_8g182630 [Beta vulgaris subsp. vulgaris] Length = 44 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 277 FVIGCTGVVMFLHGANFFFHYLSNHFAVRSLSFLGFAGW 161 FV+GCTG+VMF HGA+ FH L +H A+RSLSFLGF GW Sbjct: 6 FVLGCTGMVMFYHGAHVLFHALFSHVALRSLSFLGFVGW 44 >gb|ABR16782.1| unknown [Picea sitchensis] Length = 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = -1 Query: 286 MFEFVIGCTGVVMFLHGANFFFHYLSNHFAVRSLSFL 176 M + ++GCTGV++F+HGANFFF+Y+ H AVR+L+FL Sbjct: 1 MLDLLLGCTGVIVFIHGANFFFNYICKHVAVRALTFL 37 >ref|XP_002509440.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549339|gb|EEF50827.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 678 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 289 KMFEFVIGCTGVVMFLHGANFFFHYLSNHFAVRSL 185 ++F +GCTGVVMFLHGANFFFH LS+H A RSL Sbjct: 4 EIFVLGMGCTGVVMFLHGANFFFHVLSHHLAFRSL 38