BLASTX nr result
ID: Ophiopogon21_contig00010437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00010437 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi... 57 5e-06 >ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera] Length = 460 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 426 AAVFERGDVVDQLSNVRQIQSNNFLSKDAM 337 AAVFERGDVVDQLSNVR+IQSNN LSKDAM Sbjct: 431 AAVFERGDVVDQLSNVRRIQSNNLLSKDAM 460