BLASTX nr result
ID: Ophiopogon21_contig00010124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00010124 (1008 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010923721.1| PREDICTED: RNA polymerase II subunit 5-media... 62 6e-07 >ref|XP_010923721.1| PREDICTED: RNA polymerase II subunit 5-mediating protein homolog [Elaeis guineensis] Length = 346 Score = 62.4 bits (150), Expect = 6e-07 Identities = 31/77 (40%), Positives = 46/77 (59%) Frame = -2 Query: 728 ISDSNSTFLASDGSIKSSMASSHVKHKPISPPDPKENLRNSSDLKLKDTSDKVASETDIM 549 I++ + F S +S H K PP+PKENL +S LKL+D+S+ A +T + Sbjct: 235 IANLSMQFSGKAASFQSDREQPHSIEKSPLPPEPKENLHQASVLKLEDSSENSARQTFKI 294 Query: 548 NFSGRKAFTGSVIEHTH 498 S R+AFTGS++EH+H Sbjct: 295 GSSSRRAFTGSIVEHSH 311