BLASTX nr result
ID: Ophiopogon21_contig00008074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00008074 (382 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102882.1| Adenylate kinase B [Morus notabilis] gi|5879... 57 4e-06 ref|XP_008783799.1| PREDICTED: adenylate kinase B [Phoenix dacty... 57 5e-06 ref|XP_003578745.1| PREDICTED: adenylate kinase 3 [Brachypodium ... 56 9e-06 >ref|XP_010102882.1| Adenylate kinase B [Morus notabilis] gi|587906236|gb|EXB94319.1| Adenylate kinase B [Morus notabilis] Length = 241 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 382 DYYSKKSIVVELHAEKPPKEVTAEVQKALS 293 DYYSKKSIV LHAEKPPKEVT+EVQKALS Sbjct: 211 DYYSKKSIVANLHAEKPPKEVTSEVQKALS 240 >ref|XP_008783799.1| PREDICTED: adenylate kinase B [Phoenix dactylifera] Length = 245 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 382 DYYSKKSIVVELHAEKPPKEVTAEVQKALS 293 DYYSKKSIVV+LHA+KPPKEVT+EVQK LS Sbjct: 216 DYYSKKSIVVQLHADKPPKEVTSEVQKVLS 245 >ref|XP_003578745.1| PREDICTED: adenylate kinase 3 [Brachypodium distachyon] gi|944056129|gb|KQJ91767.1| hypothetical protein BRADI_4g39600 [Brachypodium distachyon] Length = 241 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 382 DYYSKKSIVVELHAEKPPKEVTAEVQKALS 293 DYYSKK +V LHAEKPPKEVTAEVQKALS Sbjct: 212 DYYSKKGLVANLHAEKPPKEVTAEVQKALS 241