BLASTX nr result
ID: Ophiopogon21_contig00004299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00004299 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012454444.1| PREDICTED: mitochondrial phosphate carrier p... 56 9e-06 >ref|XP_012454444.1| PREDICTED: mitochondrial phosphate carrier protein 3, mitochondrial [Gossypium raimondii] gi|763803748|gb|KJB70686.1| hypothetical protein B456_011G087200 [Gossypium raimondii] gi|763803749|gb|KJB70687.1| hypothetical protein B456_011G087200 [Gossypium raimondii] Length = 378 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -1 Query: 318 PLRIVMIGTLTGAQWGIYDAFKVFVXXXXXXXXXXXXXXLQPAK 187 PLRIVMIGTLTGAQWGIYDAFKVFV ++PAK Sbjct: 334 PLRIVMIGTLTGAQWGIYDAFKVFVGLPTTGGVAPAPAAVEPAK 377