BLASTX nr result
ID: Ophiopogon21_contig00002167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00002167 (517 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009409527.1| PREDICTED: ADP-ribosylation factor GTPase-ac... 57 7e-06 >ref|XP_009409527.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD7-like [Musa acuminata subsp. malaccensis] Length = 509 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -2 Query: 510 KGNQGGSDSWAGWDDVKDDDNNGYYNHSPSNRGSSN 403 KG Q GS+SWAGWDDVKDDD G YNHS + ++N Sbjct: 459 KGTQSGSESWAGWDDVKDDDGYGTYNHSTPSGNTTN 494