BLASTX nr result
ID: Mentha29_contig00046493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00046493 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17797.1| hypothetical protein MIMGU_mgv1a007985mg [Mimulus... 60 2e-07 >gb|EYU17797.1| hypothetical protein MIMGU_mgv1a007985mg [Mimulus guttatus] Length = 389 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/35 (82%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = -3 Query: 107 NKPSWLLCAIADLDERMKMLT-RKIPKGKSPDSFS 6 NKPSWLLC IADLDERMKMLT +KIPK SPDSF+ Sbjct: 44 NKPSWLLCTIADLDERMKMLTMKKIPKQSSPDSFA 78