BLASTX nr result
ID: Mentha29_contig00046427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00046427 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38249.1| hypothetical protein MIMGU_mgv1a026544mg [Mimulus... 67 2e-09 >gb|EYU38249.1| hypothetical protein MIMGU_mgv1a026544mg [Mimulus guttatus] Length = 449 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -2 Query: 147 MAAHTLNTVNHPLQSFTQTFRSKTFKPQRIRCRKSTSFIITSTLRVAVI 1 MAAHTL V+HPL S TQTF+SKTFKPQ ++CR +T+ ITS LR AVI Sbjct: 1 MAAHTLTPVHHPLHSLTQTFKSKTFKPQTVKCRSATT-TITSNLRAAVI 48