BLASTX nr result
ID: Mentha29_contig00046107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00046107 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30050.1| hypothetical protein MIMGU_mgv1a002663mg [Mimulus... 94 2e-17 ref|XP_006360416.1| PREDICTED: U-box domain-containing protein 1... 80 3e-13 ref|XP_004236974.1| PREDICTED: U-box domain-containing protein 1... 79 9e-13 ref|XP_006344225.1| PREDICTED: U-box domain-containing protein 1... 68 2e-09 gb|EPS71103.1| hypothetical protein M569_03654 [Genlisea aurea] 66 4e-09 ref|XP_004238849.1| PREDICTED: U-box domain-containing protein 1... 64 3e-08 >gb|EYU30050.1| hypothetical protein MIMGU_mgv1a002663mg [Mimulus guttatus] Length = 649 Score = 94.4 bits (233), Expect = 2e-17 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = +3 Query: 66 MAGGENSPAEGGATASPLRLIRDLARISSAGFSGFFKKDCSDLARRVSLLAHLLEEI 236 MA GE + AE GATA+PLRLIRD+ARIS+AGFSG FKKDC+DLARRVSLLAHLLEEI Sbjct: 1 MAAGETTAAEDGATAAPLRLIRDVARISTAGFSGVFKKDCADLARRVSLLAHLLEEI 57 >ref|XP_006360416.1| PREDICTED: U-box domain-containing protein 10-like [Solanum tuberosum] Length = 647 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = +3 Query: 66 MAGGENSPAEGGATASPLRLIRDLARISSAGFSGFFKKDCSDLARRVSLLAHLLEEI 236 MAGGE + G +T PL+++ D+ RIS AGF+GFFKKDC+DLARRVSLLA+LLEEI Sbjct: 1 MAGGEPTAVAGDSTKIPLQVVHDVCRISGAGFAGFFKKDCTDLARRVSLLAYLLEEI 57 >ref|XP_004236974.1| PREDICTED: U-box domain-containing protein 10-like [Solanum lycopersicum] Length = 647 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/57 (66%), Positives = 46/57 (80%) Frame = +3 Query: 66 MAGGENSPAEGGATASPLRLIRDLARISSAGFSGFFKKDCSDLARRVSLLAHLLEEI 236 MAGGE G +T PL+++ D+ RIS AGF+GFFKKDC+DLARRVSLLA+LLEEI Sbjct: 1 MAGGELIAVAGDSTKIPLQVVHDVCRISGAGFAGFFKKDCTDLARRVSLLAYLLEEI 57 >ref|XP_006344225.1| PREDICTED: U-box domain-containing protein 10-like [Solanum tuberosum] Length = 650 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/58 (58%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +3 Query: 66 MAGGENSPAEGG-ATASPLRLIRDLARISSAGFSGFFKKDCSDLARRVSLLAHLLEEI 236 MAGGE + G A PLRL+ ++++IS+AGF G FKKDC+DLARRV+LLAHL +E+ Sbjct: 1 MAGGEATAVAGDHPIAIPLRLLHEVSQISTAGFCGKFKKDCTDLARRVTLLAHLFDEL 58 >gb|EPS71103.1| hypothetical protein M569_03654 [Genlisea aurea] Length = 621 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/58 (58%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = +3 Query: 66 MAGGENSPAEG-GATASPLRLIRDLARISSAGFSGFFKKDCSDLARRVSLLAHLLEEI 236 MAGG+++ E G +SPL LI ++ IS+AGFSG FKKDC DL RR+ LL H LEEI Sbjct: 1 MAGGDSTEGEECGGGSSPLSLILEIEGISAAGFSGLFKKDCVDLVRRILLLTHFLEEI 58 >ref|XP_004238849.1| PREDICTED: U-box domain-containing protein 10-like [Solanum lycopersicum] Length = 650 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/58 (56%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +3 Query: 66 MAGGENSPAEGG-ATASPLRLIRDLARISSAGFSGFFKKDCSDLARRVSLLAHLLEEI 236 MAGGE + G A+ LRL+ ++++IS AGF G FKKDC+DLARRV+LLAHL +E+ Sbjct: 1 MAGGEATAVAGDHPIATLLRLLHEVSQISIAGFYGKFKKDCTDLARRVTLLAHLFDEL 58