BLASTX nr result
ID: Mentha29_contig00045782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045782 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35665.1| hypothetical protein MIMGU_mgv1a008257mg [Mimulus... 57 3e-06 >gb|EYU35665.1| hypothetical protein MIMGU_mgv1a008257mg [Mimulus guttatus] Length = 379 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/84 (42%), Positives = 50/84 (59%), Gaps = 9/84 (10%) Frame = +1 Query: 10 CTESEAEKPNIPVDE---LTRSPVSTYC---VLQNSTAVGGM---LTTQHRTPAATKKPG 162 CT++ EK NIPV+E LTRSP+S + +QN+ G TTQ R P + KKPG Sbjct: 221 CTDAGDEKRNIPVEEECLLTRSPLSGFSGAGAVQNTNTAGATKIHATTQQRKPTSAKKPG 280 Query: 163 EEDEAISRLLTKSTIVESSLEMRR 234 E+DE + L + +S+L+MRR Sbjct: 281 EDDEPTAAKLLNT---DSTLQMRR 301