BLASTX nr result
ID: Mentha29_contig00045741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045741 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD33127.1| Hemopexin [Medicago truncatula] 55 8e-06 >gb|ABD33127.1| Hemopexin [Medicago truncatula] Length = 236 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/74 (39%), Positives = 46/74 (62%) Frame = -3 Query: 223 RLRMCAEELE*WGRATGRRFRGDIKWKKE*LKCLRERTIDMGGQELIECKEDLLKLLHQE 44 RL+ C EEL+ WGR+ +R++ DI+ K+ ++ L+ E++ KE L LL QE Sbjct: 128 RLQHCTEELDQWGRSLRKRYKEDIQKCKDIIEELQGLGDVETDGEIVLLKEKLNLLLIQE 187 Query: 43 EMYWHQRAKQFWLR 2 + +W QRAK FW++ Sbjct: 188 DTFWKQRAKIFWMK 201