BLASTX nr result
ID: Mentha29_contig00045681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045681 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB28928.1| hypothetical protein L484_012687 [Morus notabilis] 59 7e-07 >gb|EXB28928.1| hypothetical protein L484_012687 [Morus notabilis] Length = 343 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/56 (42%), Positives = 36/56 (64%) Frame = +3 Query: 93 LHWVTWLKARHPDITWEKFSSALVSRFDTRFKGSPYERLMAVKQTRSVDEYIAVFV 260 LHW+ W++ + P ++WE + L+ R+ R +PYERL ++QT SV EYI FV Sbjct: 6 LHWIQWIRKKDPSLSWEVLVAELIRRYSGRKATNPYERLTTLRQTGSVAEYIEEFV 61