BLASTX nr result
ID: Mentha29_contig00045616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045616 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38971.1| hypothetical protein MIMGU_mgv1a026767mg, partial... 63 5e-08 ref|XP_006358820.1| PREDICTED: uncharacterized protein LOC102585... 59 9e-07 >gb|EYU38971.1| hypothetical protein MIMGU_mgv1a026767mg, partial [Mimulus guttatus] Length = 185 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +2 Query: 2 KEACNKAIEAETVAKERLVELNNDLSIHCRIPDLLQPKVTF 124 K+ACNKA+E E AKERL +LN +L +HCRIP L+QPKVTF Sbjct: 126 KQACNKALETEKQAKERLSQLNYELDVHCRIPMLVQPKVTF 166 >ref|XP_006358820.1| PREDICTED: uncharacterized protein LOC102585091 [Solanum tuberosum] Length = 896 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +2 Query: 2 KEACNKAIEAETVAKERLVELNNDLSIHCRIPDLLQPKVTF 124 +EAC KA+EAE AKERL ++NN+L+ HCR+P L +P+VTF Sbjct: 820 EEACAKALEAEQRAKERLSQMNNELTYHCRVPPLYRPRVTF 860