BLASTX nr result
ID: Mentha29_contig00045529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045529 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41899.1| hypothetical protein MIMGU_mgv1a009068mg [Mimulus... 59 9e-07 gb|EYU25320.1| hypothetical protein MIMGU_mgv1a006232mg [Mimulus... 57 3e-06 gb|EYU35151.1| hypothetical protein MIMGU_mgv1a025644mg, partial... 56 5e-06 >gb|EYU41899.1| hypothetical protein MIMGU_mgv1a009068mg [Mimulus guttatus] Length = 354 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/54 (48%), Positives = 39/54 (72%) Frame = -3 Query: 231 RKYIEFVDSVLESHKSTSLNKLTISLHMHASHHNLVTKWLEYVVSTKVKSLEFD 70 RKY+++V+SVL SHKST L + I ++AS N +T+WLE+ +S +V+ LE D Sbjct: 92 RKYVKWVNSVLRSHKSTVLKEFRIRFPLNASDRNTITQWLEFALSRQVQKLELD 145 >gb|EYU25320.1| hypothetical protein MIMGU_mgv1a006232mg [Mimulus guttatus] Length = 451 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 7/79 (8%) Frame = -3 Query: 228 KYIEFVDSVLESHKSTSLNKLTISLHMHASHHNLVTKWLEYVVSTKVKSLEFDFVCGKSS 49 KY+E+V+SVL+SH++ +L + I + H ++TKWLEY ++ +V+ LEFD S Sbjct: 88 KYVEWVNSVLQSHRAVTLREFRICFDLSEPSHIVLTKWLEYALARQVQRLEFDLSAANSR 147 Query: 48 -------NQVVLEKLLRQS 13 N V ++LL +S Sbjct: 148 RFGRTDLNYVFPQELLTES 166 >gb|EYU35151.1| hypothetical protein MIMGU_mgv1a025644mg, partial [Mimulus guttatus] Length = 340 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/54 (46%), Positives = 37/54 (68%) Frame = -3 Query: 228 KYIEFVDSVLESHKSTSLNKLTISLHMHASHHNLVTKWLEYVVSTKVKSLEFDF 67 KY+++VDSV+ SHKS +L + IS + S+ N +T+WLE+ S V+ LE DF Sbjct: 73 KYLKWVDSVISSHKSPTLKQFRISFPLSKSNSNSITRWLEFAFSKHVQRLELDF 126