BLASTX nr result
ID: Mentha29_contig00045079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00045079 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA60368.1| RGA [Mentha longifolia] 65 7e-09 gb|EYU24144.1| hypothetical protein MIMGU_mgv1a001094mg [Mimulus... 64 2e-08 gb|EYU21175.1| hypothetical protein MIMGU_mgv1a021134mg [Mimulus... 64 2e-08 gb|AEQ63711.1| NBS-LRR class resistance protein [Sesamum indicum] 63 4e-08 gb|ABU51860.1| putative NBS domain resistance protein [Coffea sp... 62 1e-07 gb|AAU88170.1| disease resistance-like protein [Coffea wightiana... 61 1e-07 gb|AAU88178.1| disease resistance-like protein [Coffea wightiana] 61 1e-07 gb|AAU88162.1| disease resistance-like protein [Coffea benghalen... 61 1e-07 gb|AAU88172.1| disease resistance-like protein [Coffea wightiana] 61 1e-07 gb|AAU88156.1| disease resistance-like protein [Coffea arabica] 61 1e-07 gb|AAU88165.1| disease resistance-like protein [Coffea khasiana] 61 1e-07 gb|ABU51858.1| putative NBS domain resistance protein [Coffea sp... 61 1e-07 gb|ABU51856.1| putative NBS domain resistance protein [Coffea sp... 61 1e-07 gb|ABU51855.1| putative NBS domain resistance protein [Coffea sp... 61 1e-07 emb|CAC82598.1| disease resistance-like protein [Coffea arabica] 60 4e-07 gb|ABU51859.1| putative NBS domain resistance protein [Coffea sp... 60 4e-07 gb|ABU51853.1| putative NBS domain resistance protein [Coffea sp... 60 4e-07 gb|EYU21173.1| hypothetical protein MIMGU_mgv1a002728mg [Mimulus... 59 5e-07 gb|ABU51854.1| putative NBS domain resistance protein [Coffea sp... 59 5e-07 gb|EYU17763.1| hypothetical protein MIMGU_mgv1a002610mg [Mimulus... 59 9e-07 >gb|ABA60368.1| RGA [Mentha longifolia] Length = 128 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = +3 Query: 18 TPKKVFLAVLRQLHKLPEQD---QNDWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKS 188 T K VFLA+L++L P +D + D EL++LV D L+ FL+V+D+VW EDW ++K Sbjct: 35 TKKDVFLAILKELIVRPTEDLSQKTDNELARLVSDHLQSRRFLIVMDDVWTSEDWDKIKI 94 Query: 189 AFQMSDRRSKVLITT 233 A + + KVLITT Sbjct: 95 ALPKTSKMGKVLITT 109 >gb|EYU24144.1| hypothetical protein MIMGU_mgv1a001094mg [Mimulus guttatus] Length = 891 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/79 (45%), Positives = 52/79 (65%), Gaps = 3/79 (3%) Frame = +3 Query: 18 TPKKVFLAVLRQL-HKLPEQ--DQNDWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKS 188 T K VFLA+L+++ KL ++ ++D EL+Q V LEG FL+V+D+VW +DW +LK Sbjct: 216 TSKNVFLAILKKMITKLSDEMYAKSDVELAQEVASRLEGGKFLIVMDDVWTAQDWDKLKI 275 Query: 189 AFQMSDRRSKVLITTNNDE 245 AF + R KVLIT+ E Sbjct: 276 AFPSNARMGKVLITSRQQE 294 >gb|EYU21175.1| hypothetical protein MIMGU_mgv1a021134mg [Mimulus guttatus] Length = 766 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/78 (42%), Positives = 52/78 (66%), Gaps = 2/78 (2%) Frame = +3 Query: 18 TPKKVFLAVLRQLHKLPEQDQ--NDWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSA 191 T K VFLA+L++ K+ E+ + +D EL+ LV L+ FL+V+D+VW +EDW +LK A Sbjct: 94 TRKDVFLAILKEFTKVTEETKTKSDHELAMLVAAKLDEGRFLIVMDDVWAVEDWDKLKIA 153 Query: 192 FQMSDRRSKVLITTNNDE 245 ++ KVLIT+ ++E Sbjct: 154 LPHTNSMGKVLITSRHEE 171 >gb|AEQ63711.1| NBS-LRR class resistance protein [Sesamum indicum] Length = 157 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/78 (39%), Positives = 52/78 (66%), Gaps = 2/78 (2%) Frame = +3 Query: 18 TPKKVFLAVLRQLHKLPEQ--DQNDWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSA 191 T K +FLA+L++ ++ E ++D EL+QLV L+ FL+V+D+VW +EDW L+ A Sbjct: 35 TKKDIFLAILKEFTRIDENVNGKSDHELAQLVAAHLDRGKFLIVMDDVWTVEDWNTLQIA 94 Query: 192 FQMSDRRSKVLITTNNDE 245 ++++ KVLIT+ + E Sbjct: 95 LPNNNKKGKVLITSRHVE 112 >gb|ABU51860.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 164 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 36 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPT 95 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 96 NKKRSRVLITTRN 108 >gb|AAU88170.1| disease resistance-like protein [Coffea wightiana] gi|52854235|gb|AAU88173.1| disease resistance-like protein [Coffea wightiana] gi|52854241|gb|AAU88176.1| disease resistance-like protein [Coffea wightiana] Length = 169 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 37 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 96 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 97 NKKRSRVLITTRN 109 >gb|AAU88178.1| disease resistance-like protein [Coffea wightiana] Length = 149 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 37 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 96 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 97 NKKRSRVLITTRN 109 >gb|AAU88162.1| disease resistance-like protein [Coffea benghalensis] Length = 169 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 37 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 96 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 97 NKKRSRVLITTRN 109 >gb|AAU88172.1| disease resistance-like protein [Coffea wightiana] Length = 174 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 37 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 96 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 97 NKKRSRVLITTRN 109 >gb|AAU88156.1| disease resistance-like protein [Coffea arabica] Length = 168 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 37 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 96 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 97 NKKRSRVLITTRN 109 >gb|AAU88165.1| disease resistance-like protein [Coffea khasiana] Length = 169 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 37 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 96 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 97 NKKRSRVLITTRN 109 >gb|ABU51858.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 165 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 36 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 95 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 96 NKKRSRVLITTRN 108 >gb|ABU51856.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 164 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 36 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 95 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 96 NKKRSRVLITTRN 108 >gb|ABU51855.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 164 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + +L E+ +N + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 36 EVFLNILGSIGQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 95 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 96 NKKRSRVLITTRN 108 >emb|CAC82598.1| disease resistance-like protein [Coffea arabica] Length = 168 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/73 (42%), Positives = 51/73 (69%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + L ++ QN + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 37 EVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 96 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 97 NKKRSRVLITTRN 109 >gb|ABU51859.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 163 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/73 (42%), Positives = 51/73 (69%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + L ++ QN + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 36 EVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 95 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 96 NKKRSRVLITTRN 108 >gb|ABU51853.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 163 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/73 (42%), Positives = 51/73 (69%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + L ++ QN + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 36 EVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 95 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 96 NKKRSRVLITTRN 108 >gb|EYU21173.1| hypothetical protein MIMGU_mgv1a002728mg [Mimulus guttatus] Length = 643 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/78 (41%), Positives = 49/78 (62%), Gaps = 2/78 (2%) Frame = +3 Query: 18 TPKKVFLAVLRQLHKLPEQDQ--NDWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSA 191 T K VFLA+L++ K+ E+ + +D EL+ LV L+ FL+V+D+VW EDW +LK Sbjct: 36 TRKDVFLAILKEFTKVTEETKTKSDHELAMLVAAKLDEGRFLIVMDDVWTAEDWDKLKIV 95 Query: 192 FQMSDRRSKVLITTNNDE 245 ++ KVLIT+ + E Sbjct: 96 LPHTNSMGKVLITSRHVE 113 >gb|ABU51854.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 164 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/73 (42%), Positives = 51/73 (69%), Gaps = 2/73 (2%) Frame = +3 Query: 27 KVFLAVLRQLHKLPEQDQN--DWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQM 200 +VFL +L + L ++ QN + +L++ V + L+ +L+V+D+VW+IEDW +LK AF Sbjct: 36 EVFLNILWSIGHLTKKAQNMPEEKLAKHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPN 95 Query: 201 SDRRSKVLITTNN 239 + +RS+VLITT N Sbjct: 96 NKKRSRVLITTRN 108 >gb|EYU17763.1| hypothetical protein MIMGU_mgv1a002610mg [Mimulus guttatus] Length = 654 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/70 (37%), Positives = 44/70 (62%) Frame = +3 Query: 24 KKVFLAVLRQLHKLPEQDQNDWELSQLVIDCLEGETFLVVLDNVWEIEDWRRLKSAFQMS 203 K++ L +L++ ++ ++EL Q V CL+ E FL+VLD+VW +EDW+ +K M Sbjct: 38 KELLLNILKEFTGEDMSNKGNFELEQAVRKCLKDEKFLIVLDDVWNVEDWKTIKKVLPMI 97 Query: 204 DRRSKVLITT 233 + KV+IT+ Sbjct: 98 NGLGKVIITS 107