BLASTX nr result
ID: Mentha29_contig00044983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044983 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38521.1| hypothetical protein MIMGU_mgv1a012079mg [Mimulus... 58 1e-06 >gb|EYU38521.1| hypothetical protein MIMGU_mgv1a012079mg [Mimulus guttatus] Length = 262 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/59 (55%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = -3 Query: 283 QKEAELQALKDCVKRLTEFSLVNASXXXXXXXXXDVKAITG--DGIEEKKVGTKRSIGY 113 +KEAEL+ALKDCVKRLTEFSL +AS DVKA G + + E VG K++IGY Sbjct: 204 EKEAELEALKDCVKRLTEFSLASASDEEIEDKEEDVKARDGIEENVTESMVGMKQTIGY 262