BLASTX nr result
ID: Mentha29_contig00044835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044835 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGZ20103.1| pentatricopeptide repeat-containing protein [Came... 59 9e-07 ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 gb|EYU32173.1| hypothetical protein MIMGU_mgv1a002389mg [Mimulus... 57 2e-06 ref|XP_004300812.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 dbj|BAD45723.1| putative pentatricopeptide repeat-containing pro... 57 3e-06 gb|EAZ36492.1| hypothetical protein OsJ_20823 [Oryza sativa Japo... 57 3e-06 ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_007051704.1| Pentatricopeptide repeat superfamily protein... 56 6e-06 ref|XP_006656845.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 ref|XP_004503311.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 ref|XP_004503310.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >gb|AGZ20103.1| pentatricopeptide repeat-containing protein [Camellia sinensis] Length = 771 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFVDAF 164 D+MTE C PDY+T+EIL +WLPAVG+T+KL+ FV + Sbjct: 727 DQMTEHACNPDYITMEILIDWLPAVGETEKLRSFVQGY 764 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFVDAF 164 D MTE C PDY+T+EILTEWL AVG+T KLK FV + Sbjct: 721 DRMTEHACNPDYITMEILTEWLSAVGETAKLKSFVQGY 758 >gb|EYU32173.1| hypothetical protein MIMGU_mgv1a002389mg [Mimulus guttatus] Length = 680 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFVDAF 164 D+MTEQ C PDYVT+EILTEWL VG+ +KL++FV + Sbjct: 636 DQMTEQACNPDYVTMEILTEWLSEVGEIEKLRKFVQGY 673 >ref|XP_004300812.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 763 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/38 (55%), Positives = 31/38 (81%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFVDAF 164 D+M E+ C PDY+T++ILTEWLP VG+T++L++F F Sbjct: 710 DQMVEEDCNPDYITMDILTEWLPGVGETERLRKFAQGF 747 >dbj|BAD45723.1| putative pentatricopeptide repeat-containing protein [Oryza sativa Japonica Group] Length = 629 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFV 173 D+M E++C PDYVT+++L EWLP +G+TD+LK F+ Sbjct: 552 DQMREERCFPDYVTVDVLMEWLPVIGETDRLKRFM 586 >gb|EAZ36492.1| hypothetical protein OsJ_20823 [Oryza sativa Japonica Group] Length = 604 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFV 173 D+M E++C PDYVT+++L EWLP +G+TD+LK F+ Sbjct: 552 DQMREERCFPDYVTVDVLMEWLPVIGETDRLKRFM 586 >ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Glycine max] Length = 746 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFVDAF 164 D M E+ C PDY+T+E+LTEWL AVG+ +KLK FV+ + Sbjct: 698 DRMVEEACRPDYITMEVLTEWLSAVGEIEKLKHFVEGY 735 >ref|XP_007051704.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508703965|gb|EOX95861.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 764 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFVDAF 164 D M E C PDY+T+EILTEWL AVG+++KLK FV + Sbjct: 720 DSMVEHACNPDYITMEILTEWLSAVGESEKLKSFVQGY 757 >ref|XP_006656845.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Oryza brachyantha] Length = 632 Score = 55.5 bits (132), Expect = 8e-06 Identities = 19/35 (54%), Positives = 30/35 (85%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFV 173 D+M E++C PDYVT+++L EWLP +G+T++LK F+ Sbjct: 553 DQMREERCFPDYVTVDVLMEWLPVIGETERLKRFM 587 >ref|XP_004503311.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like isoform X2 [Cicer arietinum] Length = 643 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFVDAF 164 D M E C PDYVT+EILTEWL AVG+ +KLK FV+ + Sbjct: 587 DRMVEDACSPDYVTMEILTEWLSAVGEIEKLKLFVEGY 624 >ref|XP_004503310.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like isoform X1 [Cicer arietinum] Length = 776 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 277 DEMTEQKCMPDYVTIEILTEWLPAVGKTDKLKEFVDAF 164 D M E C PDYVT+EILTEWL AVG+ +KLK FV+ + Sbjct: 720 DRMVEDACSPDYVTMEILTEWLSAVGEIEKLKLFVEGY 757