BLASTX nr result
ID: Mentha29_contig00044747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044747 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20722.1| hypothetical protein MIMGU_mgv1a026020mg [Mimulus... 99 8e-19 ref|XP_006363843.1| PREDICTED: putative pentatricopeptide repeat... 94 3e-17 ref|XP_007145648.1| hypothetical protein PHAVU_007G256700g [Phas... 91 1e-16 ref|XP_004234765.1| PREDICTED: putative pentatricopeptide repeat... 91 2e-16 ref|XP_003590373.1| Pentatricopeptide repeat protein [Medicago t... 90 3e-16 ref|XP_006490046.1| PREDICTED: putative pentatricopeptide repeat... 89 5e-16 gb|EPS66591.1| hypothetical protein M569_08182, partial [Genlise... 88 1e-15 ref|XP_006421479.1| hypothetical protein CICLE_v10006760mg [Citr... 87 2e-15 ref|XP_002526753.1| pentatricopeptide repeat-containing protein,... 87 2e-15 ref|NP_187990.1| pentatricopeptide repeat-containing protein [Ar... 85 1e-14 ref|XP_003518062.1| PREDICTED: putative pentatricopeptide repeat... 84 2e-14 ref|XP_004161498.1| PREDICTED: putative pentatricopeptide repeat... 84 2e-14 ref|XP_004136743.1| PREDICTED: putative pentatricopeptide repeat... 84 2e-14 ref|XP_006407172.1| hypothetical protein EUTSA_v10020299mg [Eutr... 84 3e-14 ref|XP_007028899.1| Pentatricopeptide repeat superfamily protein... 83 5e-14 ref|XP_002882843.1| pentatricopeptide repeat-containing protein ... 82 1e-13 ref|XP_004497943.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 81 1e-13 ref|XP_006299919.1| hypothetical protein CARUB_v10016128mg [Caps... 79 9e-13 ref|XP_004306162.1| PREDICTED: putative pentatricopeptide repeat... 79 9e-13 ref|XP_002322694.1| pentatricopeptide repeat-containing family p... 79 9e-13 >gb|EYU20722.1| hypothetical protein MIMGU_mgv1a026020mg [Mimulus guttatus] Length = 586 Score = 98.6 bits (244), Expect = 8e-19 Identities = 51/73 (69%), Positives = 55/73 (75%) Frame = -1 Query: 221 MPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCGS 42 M V G M+FK+Y +LLNECVN K + GGQ VQA MIKT YL VYL RLIVFYLKC Sbjct: 1 MSVQGLGMQFKDYDSLLNECVNQKSLIGGQRVQAHMIKTHYLPPVYLRTRLIVFYLKCEV 60 Query: 41 LDDARMVFDEMPE 3 L DARMVFDEMPE Sbjct: 61 LRDARMVFDEMPE 73 >ref|XP_006363843.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Solanum tuberosum] Length = 537 Score = 93.6 bits (231), Expect = 3e-17 Identities = 47/74 (63%), Positives = 52/74 (70%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 EM G +KFKEY LLNEC+N + IR GQ V A MIKT Y VYL RLIVFY+KCG Sbjct: 51 EMAKQGLQVKFKEYDTLLNECINQRAIREGQRVHANMIKTHYQPPVYLRTRLIVFYIKCG 110 Query: 44 SLDDARMVFDEMPE 3 L DAR VFDEMP+ Sbjct: 111 LLGDARWVFDEMPQ 124 >ref|XP_007145648.1| hypothetical protein PHAVU_007G256700g [Phaseolus vulgaris] gi|561018838|gb|ESW17642.1| hypothetical protein PHAVU_007G256700g [Phaseolus vulgaris] Length = 633 Score = 91.3 bits (225), Expect = 1e-16 Identities = 45/74 (60%), Positives = 53/74 (71%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 +M + GHDM F+ Y LLNECVN + R GQ V A MIKT YL V+L RLIVFY+KC Sbjct: 47 QMALRGHDMNFQYYNTLLNECVNKRAFREGQRVHAHMIKTNYLPCVFLWTRLIVFYVKCE 106 Query: 44 SLDDARMVFDEMPE 3 SL +AR +FDEMPE Sbjct: 107 SLTNARNLFDEMPE 120 >ref|XP_004234765.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Solanum lycopersicum] Length = 499 Score = 90.9 bits (224), Expect = 2e-16 Identities = 45/74 (60%), Positives = 52/74 (70%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 EM G +KFKEY +LNEC+N + IR GQ V A MIK+ Y VYL RLIVFY+KCG Sbjct: 27 EMAKQGLQVKFKEYDTVLNECINQRAIREGQRVHAHMIKSHYQPPVYLRTRLIVFYIKCG 86 Query: 44 SLDDARMVFDEMPE 3 L DAR VFDEMP+ Sbjct: 87 LLGDARWVFDEMPQ 100 >ref|XP_003590373.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355479421|gb|AES60624.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 840 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/74 (60%), Positives = 52/74 (70%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 +M + G +MKF+ Y A+LNECVN + R GQ V A MIKTRYL V+L RLIV Y KC Sbjct: 233 QMALHGFNMKFENYNAILNECVNKRAFREGQRVHAHMIKTRYLPSVFLRTRLIVLYTKCD 292 Query: 44 SLDDARMVFDEMPE 3 SL DA VFDEMPE Sbjct: 293 SLGDAHNVFDEMPE 306 >ref|XP_006490046.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Citrus sinensis] Length = 644 Score = 89.4 bits (220), Expect = 5e-16 Identities = 46/74 (62%), Positives = 52/74 (70%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 EM LG +M+F+EY ALLN CVN + +RGGQ V A MIKT Y VYL RLIVFY KC Sbjct: 58 EMATLGLEMRFEEYDALLNACVNQRTLRGGQRVHAHMIKTCYRPPVYLRTRLIVFYNKCE 117 Query: 44 SLDDARMVFDEMPE 3 L DAR +FDEM E Sbjct: 118 CLSDARKMFDEMRE 131 >gb|EPS66591.1| hypothetical protein M569_08182, partial [Genlisea aurea] Length = 455 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/69 (63%), Positives = 51/69 (73%) Frame = -1 Query: 209 GHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCGSLDDA 30 G MKFKE+ ALL+ECV K +RGGQTVQ M+K RYL YL RLI+ YL+C LDDA Sbjct: 1 GFRMKFKEFDALLSECVKLKCLRGGQTVQVLMMKMRYLPPSYLTRRLILLYLRCDVLDDA 60 Query: 29 RMVFDEMPE 3 R VFDEMP+ Sbjct: 61 RKVFDEMPD 69 >ref|XP_006421479.1| hypothetical protein CICLE_v10006760mg [Citrus clementina] gi|557523352|gb|ESR34719.1| hypothetical protein CICLE_v10006760mg [Citrus clementina] Length = 688 Score = 87.0 bits (214), Expect = 2e-15 Identities = 45/73 (61%), Positives = 50/73 (68%) Frame = -1 Query: 221 MPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCGS 42 M LG +M+F+EY LLN CVN + +RGGQ V A MIKT Y VYL RLIVFY KC Sbjct: 1 MATLGLEMRFEEYDTLLNACVNQRTLRGGQKVHAHMIKTCYRPPVYLRTRLIVFYNKCEC 60 Query: 41 LDDARMVFDEMPE 3 L DAR VFDEM E Sbjct: 61 LSDARKVFDEMRE 73 >ref|XP_002526753.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533942|gb|EEF35667.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 818 Score = 87.0 bits (214), Expect = 2e-15 Identities = 47/74 (63%), Positives = 50/74 (67%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 EM G +MKF Y LLNECVN+K IR GQ V A +IKT YL VYL RLIVFY KC Sbjct: 465 EMACQGLEMKFDGYNTLLNECVNNKAIREGQRVHAHIIKTYYLPSVYLRTRLIVFYTKCD 524 Query: 44 SLDDARMVFDEMPE 3 L DAR VFDEM E Sbjct: 525 LLMDARHVFDEMSE 538 >ref|NP_187990.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273354|sp|Q9LIC3.1|PP227_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial; Flags: Precursor gi|9294022|dbj|BAB01925.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332641888|gb|AEE75409.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 628 Score = 84.7 bits (208), Expect = 1e-14 Identities = 42/74 (56%), Positives = 51/74 (68%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 EM +LG +M F Y ALLN C++ + +R GQ V A MIKTRYL YL RL++FY KC Sbjct: 42 EMAMLGPEMGFHGYDALLNACLDKRALRDGQRVHAHMIKTRYLPATYLRTRLLIFYGKCD 101 Query: 44 SLDDARMVFDEMPE 3 L+DAR V DEMPE Sbjct: 102 CLEDARKVLDEMPE 115 >ref|XP_003518062.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like isoform X1 [Glycine max] gi|571440626|ref|XP_006575216.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like isoform X2 [Glycine max] Length = 634 Score = 84.3 bits (207), Expect = 2e-14 Identities = 43/73 (58%), Positives = 50/73 (68%) Frame = -1 Query: 221 MPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCGS 42 M + G D F++Y +LNEC+ + IR GQ V A MIKT YL VYL RLIVFY+KC S Sbjct: 49 MALRGLDTNFQDYNTVLNECLRKRAIREGQRVHAHMIKTHYLPCVYLRTRLIVFYVKCDS 108 Query: 41 LDDARMVFDEMPE 3 L DAR VFD MPE Sbjct: 109 LRDARHVFDVMPE 121 >ref|XP_004161498.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Cucumis sativus] Length = 638 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/74 (55%), Positives = 52/74 (70%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 +M +LG ++KF+ Y ++LNECV+ + IR GQ V MIKT YL VYL RLIV Y KC Sbjct: 52 QMAILGREVKFEGYDSILNECVSQRAIREGQRVHTHMIKTCYLPSVYLRTRLIVLYNKCD 111 Query: 44 SLDDARMVFDEMPE 3 L DAR +FDEMP+ Sbjct: 112 CLGDARGMFDEMPQ 125 >ref|XP_004136743.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Cucumis sativus] Length = 666 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/74 (55%), Positives = 51/74 (68%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 +M +LG ++KF+ Y +LNECV+ + IR GQ V MIKT YL VYL RLIV Y KC Sbjct: 80 QMAILGREVKFEGYDTILNECVSQRAIREGQRVHTHMIKTCYLPSVYLRTRLIVLYNKCD 139 Query: 44 SLDDARMVFDEMPE 3 L DAR +FDEMP+ Sbjct: 140 CLGDAREMFDEMPQ 153 >ref|XP_006407172.1| hypothetical protein EUTSA_v10020299mg [Eutrema salsugineum] gi|557108318|gb|ESQ48625.1| hypothetical protein EUTSA_v10020299mg [Eutrema salsugineum] Length = 627 Score = 83.6 bits (205), Expect = 3e-14 Identities = 42/74 (56%), Positives = 50/74 (67%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 +M VLGH+M F Y ALLN C++ + +R GQ V A MIKT YL YL RL++FY KC Sbjct: 41 KMSVLGHEMGFHGYDALLNACLDKRALRQGQRVHAHMIKTCYLPATYLRTRLLIFYGKCD 100 Query: 44 SLDDARMVFDEMPE 3 L DAR V DEMPE Sbjct: 101 CLKDARKVLDEMPE 114 >ref|XP_007028899.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508717504|gb|EOY09401.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 718 Score = 82.8 bits (203), Expect = 5e-14 Identities = 42/73 (57%), Positives = 49/73 (67%) Frame = -1 Query: 221 MPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCGS 42 M V G +M+F+ Y LLN C+N + R GQ V A MIKTRYL VYL RLI+FY KC Sbjct: 1 MAVQGLEMRFESYDMLLNACINKRRFREGQRVHAHMIKTRYLPPVYLRTRLIIFYGKCDC 60 Query: 41 LDDARMVFDEMPE 3 L +AR V DEMPE Sbjct: 61 LREARHVLDEMPE 73 >ref|XP_002882843.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328683|gb|EFH59102.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 627 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/74 (55%), Positives = 51/74 (68%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 EM +LG ++ F Y ALLN C++ + +R GQ V A MIKTRYL YL RL++FY KC Sbjct: 41 EMVMLGPEIGFHCYDALLNACLDKRALREGQRVHAHMIKTRYLPATYLRTRLLIFYGKCD 100 Query: 44 SLDDARMVFDEMPE 3 L+DAR V DEMPE Sbjct: 101 CLEDARKVLDEMPE 114 >ref|XP_004497943.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Cicer arietinum] Length = 642 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/74 (55%), Positives = 48/74 (64%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 +M + +M F+ Y LLNEC+N K R GQ V A +IKTRYL V+L R IVFY KC Sbjct: 30 QMALQAFNMNFENYNQLLNECINKKAYREGQRVHAHIIKTRYLPSVFLRTRFIVFYTKCH 89 Query: 44 SLDDARMVFDEMPE 3 SL DA VFDEM E Sbjct: 90 SLKDAHHVFDEMTE 103 >ref|XP_006299919.1| hypothetical protein CARUB_v10016128mg [Capsella rubella] gi|482568628|gb|EOA32817.1| hypothetical protein CARUB_v10016128mg [Capsella rubella] Length = 634 Score = 78.6 bits (192), Expect = 9e-13 Identities = 40/74 (54%), Positives = 49/74 (66%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 EM +LG + F Y ALLN C++ + +R GQ V A MIKT YL YL RL++FY KC Sbjct: 48 EMVMLGPETGFHGYDALLNACLDKRALRQGQRVHAHMIKTCYLPATYLRTRLLIFYGKCD 107 Query: 44 SLDDARMVFDEMPE 3 L+DAR V DEMPE Sbjct: 108 RLEDARKVLDEMPE 121 >ref|XP_004306162.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 637 Score = 78.6 bits (192), Expect = 9e-13 Identities = 43/74 (58%), Positives = 47/74 (63%) Frame = -1 Query: 224 EMPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCG 45 EM V G MKF+ Y LLNECV + R GQ V A MIKT YL V+L RLIVFY C Sbjct: 51 EMTVQGLAMKFEGYYTLLNECVTRRAFREGQRVHAHMIKTCYLPPVHLQTRLIVFYNNCD 110 Query: 44 SLDDARMVFDEMPE 3 L DAR V DEMP+ Sbjct: 111 CLRDARRVLDEMPQ 124 >ref|XP_002322694.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222867324|gb|EEF04455.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 586 Score = 78.6 bits (192), Expect = 9e-13 Identities = 41/73 (56%), Positives = 47/73 (64%) Frame = -1 Query: 221 MPVLGHDMKFKEYGALLNECVNHKYIRGGQTVQAQMIKTRYLRHVYLGGRLIVFYLKCGS 42 M + G ++KF Y LLNECVN + +R GQ V A MIKT YL VYL RLI+ Y KC Sbjct: 1 MAIQGPEIKFDGYNMLLNECVNKRAVREGQRVHAHMIKTCYLPPVYLSTRLIILYTKCEC 60 Query: 41 LDDARMVFDEMPE 3 L AR VFDEM E Sbjct: 61 LGCARHVFDEMRE 73