BLASTX nr result
ID: Mentha29_contig00044475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044475 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26921.1| hypothetical protein MIMGU_mgv1a003544mg [Mimulus... 74 3e-11 ref|XP_003628012.1| Protein regulator of cytokinesis [Medicago t... 59 5e-07 ref|XP_004147082.1| PREDICTED: 65-kDa microtubule-associated pro... 57 3e-06 >gb|EYU26921.1| hypothetical protein MIMGU_mgv1a003544mg [Mimulus guttatus] Length = 579 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/45 (80%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = +3 Query: 6 ATPNSRRVGTPA-RFGVSGGNGRRESGKVGTVIPINYVALSKDER 137 ATPNSRRVGTP+ RFG+SGG RR+SGKV TVIPINYVAL KD+R Sbjct: 533 ATPNSRRVGTPSSRFGISGGKDRRDSGKVATVIPINYVALPKDDR 577 >ref|XP_003628012.1| Protein regulator of cytokinesis [Medicago truncatula] gi|355522034|gb|AET02488.1| Protein regulator of cytokinesis [Medicago truncatula] Length = 568 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/45 (60%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +3 Query: 3 AATPNSRRVGTPA-RFGVSGGNGRRESGKVGTVIPINYVALSKDE 134 A TPN RR+ TP+ R+G SG RRESG+V +IP+NYVAL+KD+ Sbjct: 518 AGTPNGRRMHTPSGRYGTSGAKDRRESGRVNNIIPVNYVALAKDD 562 >ref|XP_004147082.1| PREDICTED: 65-kDa microtubule-associated protein 5-like [Cucumis sativus] gi|449516970|ref|XP_004165519.1| PREDICTED: 65-kDa microtubule-associated protein 5-like [Cucumis sativus] Length = 563 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +3 Query: 21 RRVGTPARFGVSGGNGRRESGKVGTVIPINYVALSKDE 134 RR+GTP R+G SG RRESG+V +IP+NYVAL KD+ Sbjct: 520 RRIGTPGRYGFSGSKDRRESGRVPNIIPVNYVALPKDD 557