BLASTX nr result
ID: Mentha29_contig00044338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044338 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU89742.1| serine/threonine protein kinase-like [Solanum tub... 62 8e-08 ref|XP_007046228.1| Kinase superfamily protein [Theobroma cacao]... 60 1e-07 ref|XP_004297338.1| PREDICTED: probable receptor-like protein ki... 60 1e-07 ref|XP_007222609.1| hypothetical protein PRUPE_ppa004933mg [Prun... 60 1e-07 gb|EXB63815.1| putative receptor-like protein kinase [Morus nota... 60 1e-07 gb|EYU28703.1| hypothetical protein MIMGU_mgv1a005501mg [Mimulus... 60 1e-07 ref|XP_006378157.1| hypothetical protein POPTR_0010s04270g [Popu... 60 1e-07 ref|XP_004238768.1| PREDICTED: probable receptor-like protein ki... 60 1e-07 ref|XP_006357263.1| PREDICTED: probable receptor-like protein ki... 60 1e-07 gb|EPS73632.1| hypothetical protein M569_01122, partial [Genlise... 60 1e-07 emb|CAN82516.1| hypothetical protein VITISV_008843 [Vitis vinifera] 59 2e-07 ref|XP_003517927.1| PREDICTED: probable receptor-like protein ki... 59 2e-07 ref|XP_007157391.1| hypothetical protein PHAVU_002G066400g [Phas... 59 2e-07 gb|ABR18367.1| unknown [Picea sitchensis] gi|148910798|gb|ABR184... 59 2e-07 ref|XP_006363918.1| PREDICTED: probable receptor-like protein ki... 59 2e-07 ref|XP_004228384.1| PREDICTED: probable receptor-like protein ki... 59 2e-07 ref|XP_003631281.1| PREDICTED: probable receptor-like protein ki... 59 2e-07 gb|EYU22440.1| hypothetical protein MIMGU_mgv1a005991mg [Mimulus... 59 2e-07 ref|XP_002520138.1| Protein kinase APK1B, chloroplast precursor,... 59 3e-07 ref|XP_002311801.1| hypothetical protein POPTR_0008s19920g [Popu... 59 3e-07 >gb|AAU89742.1| serine/threonine protein kinase-like [Solanum tuberosum] Length = 603 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 117 VGQAEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 + QAEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 296 IWQAEVNFLGDLVHPNLVKLIGYCIEDDQRL 326 >ref|XP_007046228.1| Kinase superfamily protein [Theobroma cacao] gi|508710163|gb|EOY02060.1| Kinase superfamily protein [Theobroma cacao] Length = 517 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 184 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 211 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 177 QGHKEWL 183 >ref|XP_004297338.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Fragaria vesca subsp. vesca] Length = 488 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 186 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 213 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 179 QGHKEWL 185 >ref|XP_007222609.1| hypothetical protein PRUPE_ppa004933mg [Prunus persica] gi|462419545|gb|EMJ23808.1| hypothetical protein PRUPE_ppa004933mg [Prunus persica] Length = 485 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 180 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 207 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 173 QGHKEWL 179 >gb|EXB63815.1| putative receptor-like protein kinase [Morus notabilis] Length = 483 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 179 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 206 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 172 QGHKEWL 178 >gb|EYU28703.1| hypothetical protein MIMGU_mgv1a005501mg [Mimulus guttatus] Length = 481 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 175 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 202 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 168 QGHKEWL 174 >ref|XP_006378157.1| hypothetical protein POPTR_0010s04270g [Populus trichocarpa] gi|550329027|gb|ERP55954.1| hypothetical protein POPTR_0010s04270g [Populus trichocarpa] Length = 480 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 176 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 203 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 169 QGHKEWL 175 >ref|XP_004238768.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Solanum lycopersicum] Length = 478 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 174 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 201 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 167 QGHKEWL 173 >ref|XP_006357263.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Solanum tuberosum] Length = 477 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 173 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 200 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 166 QGHKEWL 172 >gb|EPS73632.1| hypothetical protein M569_01122, partial [Genlisea aurea] Length = 358 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKLIGYCIEDDQRL Sbjct: 112 AEVNFLGDLVHPNLVKLIGYCIEDDQRL 139 Score = 21.6 bits (44), Expect(2) = 1e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 105 QGHKEWL 111 >emb|CAN82516.1| hypothetical protein VITISV_008843 [Vitis vinifera] Length = 495 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD +HPNLVKLIGYCIEDDQRL Sbjct: 189 AEVNFLGDLIHPNLVKLIGYCIEDDQRL 216 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 182 QGHKEWL 188 >ref|XP_003517927.1| PREDICTED: probable receptor-like protein kinase At5g15080-like isoform X1 [Glycine max] gi|571434065|ref|XP_006573089.1| PREDICTED: probable receptor-like protein kinase At5g15080-like isoform X2 [Glycine max] Length = 491 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKL+GYCIEDDQRL Sbjct: 188 AEVNFLGDLVHPNLVKLVGYCIEDDQRL 215 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 181 QGHKEWL 187 >ref|XP_007157391.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris] gi|593788706|ref|XP_007157392.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris] gi|593788708|ref|XP_007157393.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris] gi|561030806|gb|ESW29385.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris] gi|561030807|gb|ESW29386.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris] gi|561030808|gb|ESW29387.1| hypothetical protein PHAVU_002G066400g [Phaseolus vulgaris] Length = 484 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKL+GYCIEDDQRL Sbjct: 182 AEVNFLGDLVHPNLVKLVGYCIEDDQRL 209 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 175 QGHKEWL 181 >gb|ABR18367.1| unknown [Picea sitchensis] gi|148910798|gb|ABR18465.1| unknown [Picea sitchensis] Length = 484 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD +HPNLVKLIGYCIEDDQRL Sbjct: 180 AEVNFLGDLIHPNLVKLIGYCIEDDQRL 207 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 173 QGHKEWL 179 >ref|XP_006363918.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Solanum tuberosum] Length = 482 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD +HPNLVKLIGYCIEDDQRL Sbjct: 174 AEVNFLGDLIHPNLVKLIGYCIEDDQRL 201 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 167 QGHKEWL 173 >ref|XP_004228384.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Solanum lycopersicum] Length = 481 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD +HPNLVKLIGYCIEDDQRL Sbjct: 174 AEVNFLGDLIHPNLVKLIGYCIEDDQRL 201 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 167 QGHKEWL 173 >ref|XP_003631281.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Vitis vinifera] gi|296086431|emb|CBI32020.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD +HPNLVKLIGYCIEDDQRL Sbjct: 175 AEVNFLGDLIHPNLVKLIGYCIEDDQRL 202 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 168 QGHKEWL 174 >gb|EYU22440.1| hypothetical protein MIMGU_mgv1a005991mg [Mimulus guttatus] Length = 462 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVNFLGD VHPNLVKL+GYCIEDDQRL Sbjct: 155 AEVNFLGDLVHPNLVKLVGYCIEDDQRL 182 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 148 QGHKEWL 154 >ref|XP_002520138.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] gi|223540630|gb|EEF42193.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] Length = 495 Score = 58.5 bits (140), Expect(2) = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVN+LGD VHPNLVKLIGYCIEDDQRL Sbjct: 192 AEVNYLGDLVHPNLVKLIGYCIEDDQRL 219 Score = 21.6 bits (44), Expect(2) = 3e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 185 QGHKEWL 191 >ref|XP_002311801.1| hypothetical protein POPTR_0008s19920g [Populus trichocarpa] gi|222851621|gb|EEE89168.1| hypothetical protein POPTR_0008s19920g [Populus trichocarpa] Length = 478 Score = 58.5 bits (140), Expect(2) = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 126 AEVNFLGDCVHPNLVKLIGYCIEDDQRL 209 AEVN+LGD VHPNLVKLIGYCIEDDQRL Sbjct: 174 AEVNYLGDLVHPNLVKLIGYCIEDDQRL 201 Score = 21.6 bits (44), Expect(2) = 3e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 1 QGHKEWL 21 QGHKEWL Sbjct: 167 QGHKEWL 173