BLASTX nr result
ID: Mentha29_contig00044333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044333 (493 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_068729.1| putative reverse transcriptase [Soybean chlorot... 59 9e-07 >ref|NP_068729.1| putative reverse transcriptase [Soybean chlorotic mottle virus] gi|18266821|sp|P15629.2|POL_SOCMV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|11322953|emb|CAC16945.1| putative reverse transcriptase [Soybean chlorotic mottle virus] Length = 692 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = -1 Query: 472 GRLIRWYQRFNLFNPIIRLEKSENNPFADTLTREWREP 359 GRLIRW R + P + L KSENNPFADTLTREW +P Sbjct: 652 GRLIRWQLRLQAYQPYVELIKSENNPFADTLTREWSKP 689