BLASTX nr result
ID: Mentha29_contig00044234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044234 (227 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509956.1| protein binding protein, putative [Ricinus c... 57 4e-06 >ref|XP_002509956.1| protein binding protein, putative [Ricinus communis] gi|223549855|gb|EEF51343.1| protein binding protein, putative [Ricinus communis] Length = 597 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +2 Query: 41 SSPSRVATRTPKGKNKQGRMSMSAPARSDQSFLDQRLKYDREELLALQFSST 196 +SPSR+ +R P KQG+M +S P Q F+DQRLKY REELLALQ+ S+ Sbjct: 531 ASPSRILSRPPHVSRKQGKMPVSWPM--PQHFIDQRLKYSREELLALQYQSS 580