BLASTX nr result
ID: Mentha29_contig00044170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044170 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33913.1| hypothetical protein MIMGU_mgv1a007626mg [Mimulus... 59 7e-07 >gb|EYU33913.1| hypothetical protein MIMGU_mgv1a007626mg [Mimulus guttatus] Length = 401 Score = 58.9 bits (141), Expect = 7e-07 Identities = 37/81 (45%), Positives = 50/81 (61%), Gaps = 10/81 (12%) Frame = +1 Query: 175 LLCHRLFTIIGGLKSESQLAGMVLNSND-SKHLNQPISMEEKESPDPPFEKTYRNLFDNA 351 LL F+ + +S+ A MV++S D S+HLNQ +SMEE + DPPFEKTY++LF N Sbjct: 24 LLLPNSFSNLRRQPPKSKYAVMVVSSADQSEHLNQQVSMEE--TADPPFEKTYKSLFSNL 81 Query: 352 VE---------MPEVSAVEEC 387 MPE+S+VEEC Sbjct: 82 TATAPPQKMNLMPELSSVEEC 102