BLASTX nr result
ID: Mentha29_contig00044141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00044141 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28876.1| hypothetical protein MIMGU_mgv1a002432mg [Mimulus... 57 2e-06 >gb|EYU28876.1| hypothetical protein MIMGU_mgv1a002432mg [Mimulus guttatus] Length = 676 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = +2 Query: 2 KTDRKKSSYSGRSVNAPSSYSKPRSGAAAPVWERRIPRGGIXXXXXXXXXNAGDFSTFVV 181 K DR++S+Y R+ N S Y+KPRS +AAP W+RR P I AGDFSTFVV Sbjct: 102 KPDRRRSNYPDRNANVNSPYAKPRSTSAAPFWDRRSPSSKIGNEEENA---AGDFSTFVV 158